BLASTX nr result
ID: Akebia23_contig00024473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00024473 (491 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007220387.1| hypothetical protein PRUPE_ppa021697mg [Prun... 48 3e-06 >ref|XP_007220387.1| hypothetical protein PRUPE_ppa021697mg [Prunus persica] gi|462416849|gb|EMJ21586.1| hypothetical protein PRUPE_ppa021697mg [Prunus persica] Length = 513 Score = 47.8 bits (112), Expect(2) = 3e-06 Identities = 31/55 (56%), Positives = 33/55 (60%), Gaps = 3/55 (5%) Frame = -2 Query: 217 RLCLCNTI---S*DLNQLQCDLFVNLLRSKPPNLTLEVQLLHMIFEKEKPHKAHS 62 RL LCNTI S Q QC+L NLLRSKP QLL MIFE +PHKA S Sbjct: 47 RLWLCNTIAGISSISRQHQCELLTNLLRSKPLKRGFASQLLEMIFE-NRPHKAGS 100 Score = 28.9 bits (63), Expect(2) = 3e-06 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -3 Query: 324 NDDGDSDAAKQRISMLKKLE 265 ND+GD ++AK R+S+L LE Sbjct: 12 NDNGDDNSAKMRVSLLSNLE 31