BLASTX nr result
ID: Akebia23_contig00024360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00024360 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007211244.1| hypothetical protein PRUPE_ppa015858mg, part... 70 4e-10 ref|XP_007050821.1| Mitochondrial transcription termination fact... 69 9e-10 ref|XP_002271898.1| PREDICTED: uncharacterized protein LOC100258... 67 3e-09 ref|XP_006397978.1| hypothetical protein EUTSA_v10001776mg, part... 65 8e-09 ref|XP_002520663.1| conserved hypothetical protein [Ricinus comm... 65 1e-08 emb|CAN68940.1| hypothetical protein VITISV_028995 [Vitis vinifera] 65 1e-08 gb|EXB94317.1| hypothetical protein L484_002678 [Morus notabilis] 65 1e-08 ref|XP_002271799.2| PREDICTED: uncharacterized protein LOC100246... 65 1e-08 ref|XP_002321027.2| hypothetical protein POPTR_0014s12770g [Popu... 64 3e-08 ref|XP_002511212.1| conserved hypothetical protein [Ricinus comm... 64 3e-08 emb|CAN68941.1| hypothetical protein VITISV_028996 [Vitis vinifera] 63 4e-08 ref|XP_006477559.1| PREDICTED: uncharacterized protein LOC102611... 63 5e-08 ref|XP_006440079.1| hypothetical protein CICLE_v10020122mg [Citr... 63 5e-08 ref|XP_003559733.1| PREDICTED: uncharacterized protein LOC100833... 62 6e-08 ref|XP_002278053.2| PREDICTED: uncharacterized protein LOC100264... 62 8e-08 ref|XP_002271867.1| PREDICTED: uncharacterized protein LOC100263... 62 8e-08 emb|CAN72401.1| hypothetical protein VITISV_012129 [Vitis vinifera] 62 8e-08 ref|XP_006363159.1| PREDICTED: uncharacterized protein LOC102589... 62 1e-07 ref|XP_004962127.1| PREDICTED: uncharacterized protein LOC101759... 62 1e-07 ref|NP_001059486.1| Os07g0423000 [Oryza sativa Japonica Group] g... 61 1e-07 >ref|XP_007211244.1| hypothetical protein PRUPE_ppa015858mg, partial [Prunus persica] gi|462406979|gb|EMJ12443.1| hypothetical protein PRUPE_ppa015858mg, partial [Prunus persica] Length = 510 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/63 (47%), Positives = 44/63 (69%) Frame = -1 Query: 332 RIVPRCTVLEILESKGMIRRKVKVTSILALTEKKFFDKFVMKYHETIPEVMKAYKGGIEF 153 RI+PRC+VL++L S+G I+ VK +L +T K F + + KY +P+++KAYKG IEF Sbjct: 333 RIIPRCSVLQLLLSQGFIKEDVKFPHVLKMTNKNFRRRILSKYEAVVPDIVKAYKGKIEF 392 Query: 152 SGF 144 GF Sbjct: 393 QGF 395 >ref|XP_007050821.1| Mitochondrial transcription termination factor family protein [Theobroma cacao] gi|508703082|gb|EOX94978.1| Mitochondrial transcription termination factor family protein [Theobroma cacao] Length = 402 Score = 68.6 bits (166), Expect = 9e-10 Identities = 27/62 (43%), Positives = 45/62 (72%) Frame = -1 Query: 332 RIVPRCTVLEILESKGMIRRKVKVTSILALTEKKFFDKFVMKYHETIPEVMKAYKGGIEF 153 RI+PRC+V +IL SKG+I+ +T++L EK+F ++FV KY E +P+++ Y+G ++F Sbjct: 340 RIIPRCSVFQILLSKGLIKEDFSLTTVLLPVEKRFLERFVTKYQEEVPDLLSVYQGKVKF 399 Query: 152 SG 147 G Sbjct: 400 EG 401 >ref|XP_002271898.1| PREDICTED: uncharacterized protein LOC100258309 [Vitis vinifera] gi|297744182|emb|CBI37152.3| unnamed protein product [Vitis vinifera] Length = 412 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/70 (44%), Positives = 48/70 (68%), Gaps = 2/70 (2%) Frame = -1 Query: 332 RIVPRCTVLEILESKGMIRRKVKVTSILALTEKKFFDKFVMKYHETIPEVMKAYKG--GI 159 RI+PRC+V ++L KG++++ + + + L LTEKKFFD+FV+KY IP+++ YKG G+ Sbjct: 337 RIIPRCSVGKVLILKGLVKKDLSLGAFLKLTEKKFFDRFVIKYQNHIPQLLNLYKGEVGV 396 Query: 158 EFSGFGERRI 129 GF I Sbjct: 397 LELGFASEEI 406 >ref|XP_006397978.1| hypothetical protein EUTSA_v10001776mg, partial [Eutrema salsugineum] gi|557099051|gb|ESQ39431.1| hypothetical protein EUTSA_v10001776mg, partial [Eutrema salsugineum] Length = 362 Score = 65.5 bits (158), Expect = 8e-09 Identities = 27/56 (48%), Positives = 42/56 (75%) Frame = -1 Query: 332 RIVPRCTVLEILESKGMIRRKVKVTSILALTEKKFFDKFVMKYHETIPEVMKAYKG 165 RI+PRC+V+++L SKGM+++ +TS+L EK F +K V+KY E +PE+M Y+G Sbjct: 303 RIIPRCSVIKVLASKGMVKQDWSLTSLLVPVEKVFLEKLVIKYEEELPELMDVYRG 358 >ref|XP_002520663.1| conserved hypothetical protein [Ricinus communis] gi|223540048|gb|EEF41625.1| conserved hypothetical protein [Ricinus communis] Length = 377 Score = 65.1 bits (157), Expect = 1e-08 Identities = 26/59 (44%), Positives = 44/59 (74%) Frame = -1 Query: 332 RIVPRCTVLEILESKGMIRRKVKVTSILALTEKKFFDKFVMKYHETIPEVMKAYKGGIE 156 RIVPRC V+ +L +KG++++ V + ++L TEK F D+FV+KY E +P +++ Y+G I+ Sbjct: 314 RIVPRCRVIRVLMNKGLVKKDVSLATVLVPTEKCFLDRFVIKYEEEVPLLLRVYEGKID 372 >emb|CAN68940.1| hypothetical protein VITISV_028995 [Vitis vinifera] Length = 379 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/71 (40%), Positives = 49/71 (69%), Gaps = 2/71 (2%) Frame = -1 Query: 332 RIVPRCTVLEILESKGMIRRKVKVTSILALTEKKFFDKFVMKYHETIPEVMKAYKG--GI 159 +I+PRC+V+++L+ KG++++ + + IL +E FFDKFV+KY + +PE++ Y+G GI Sbjct: 305 KIIPRCSVVKVLQMKGLVKKDLCL-GILGCSENNFFDKFVLKYEQEVPELLNVYQGKIGI 363 Query: 158 EFSGFGERRIW 126 GF IW Sbjct: 364 LELGFVSEEIW 374 >gb|EXB94317.1| hypothetical protein L484_002678 [Morus notabilis] Length = 424 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/63 (42%), Positives = 44/63 (69%) Frame = -1 Query: 332 RIVPRCTVLEILESKGMIRRKVKVTSILALTEKKFFDKFVMKYHETIPEVMKAYKGGIEF 153 R +PR +VL++L SKG ++ + + L +TEKKF + + Y +++P+V+KAY+G IEF Sbjct: 356 RFIPRISVLQLLMSKGFVKEDISIIPYLRMTEKKFKENIMSVYEKSLPDVVKAYQGKIEF 415 Query: 152 SGF 144 GF Sbjct: 416 RGF 418 >ref|XP_002271799.2| PREDICTED: uncharacterized protein LOC100246295 [Vitis vinifera] Length = 387 Score = 64.7 bits (156), Expect = 1e-08 Identities = 25/66 (37%), Positives = 50/66 (75%), Gaps = 2/66 (3%) Frame = -1 Query: 332 RIVPRCTVLEILESKGMIRRKVKVTSILALTEKKFFDKFVMKYHETIPEVMKAYKGGIEF 153 R+VPRC+V+++L KG++++ ++ ++ L LTE+ F DK+V+K+ + +P+++ Y+G + F Sbjct: 321 RVVPRCSVVKVLLLKGLVKKDMRSSTFLKLTERDFLDKYVIKHQDNVPQLLDLYQGKVSF 380 Query: 152 S--GFG 141 + GFG Sbjct: 381 AELGFG 386 >ref|XP_002321027.2| hypothetical protein POPTR_0014s12770g [Populus trichocarpa] gi|550324082|gb|EEE99342.2| hypothetical protein POPTR_0014s12770g [Populus trichocarpa] Length = 400 Score = 63.5 bits (153), Expect = 3e-08 Identities = 23/62 (37%), Positives = 45/62 (72%) Frame = -1 Query: 332 RIVPRCTVLEILESKGMIRRKVKVTSILALTEKKFFDKFVMKYHETIPEVMKAYKGGIEF 153 RI+PRC V+++L SKG+I++ + + ++L EK+F ++FV K+ E +P+++ Y+G ++ Sbjct: 338 RIIPRCKVIQVLWSKGLIKKDISLNTVLLPVEKRFLERFVTKFEEEVPQLLSVYEGKVDP 397 Query: 152 SG 147 G Sbjct: 398 EG 399 >ref|XP_002511212.1| conserved hypothetical protein [Ricinus communis] gi|223550327|gb|EEF51814.1| conserved hypothetical protein [Ricinus communis] Length = 423 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/63 (46%), Positives = 43/63 (68%) Frame = -1 Query: 332 RIVPRCTVLEILESKGMIRRKVKVTSILALTEKKFFDKFVMKYHETIPEVMKAYKGGIEF 153 RI+PRC+VL IL SK +I K+ +L +TEK F V KY + +PE+++A++G +EF Sbjct: 355 RILPRCSVLNILMSKELINEGFKLIYMLRMTEKMFGKNVVTKYQDLVPEIVEAHQGRVEF 414 Query: 152 SGF 144 GF Sbjct: 415 QGF 417 >emb|CAN68941.1| hypothetical protein VITISV_028996 [Vitis vinifera] Length = 2634 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/84 (35%), Positives = 55/84 (65%) Frame = -1 Query: 332 RIVPRCTVLEILESKGMIRRKVKVTSILALTEKKFFDKFVMKYHETIPEVMKAYKGGIEF 153 +I+PRC+V+++L+ KG++++ + + IL +E+ FFDKFV+KY + +PE++ Y+G I Sbjct: 324 KIIPRCSVVKVLQMKGLVKKDLCL-GILGCSEENFFDKFVVKYEQDVPELLNVYQGKIGI 382 Query: 152 SGFGERRIWWG*GLFERGKKKRTR 81 G + G + RG+ +R R Sbjct: 383 LELG--FVSEGLDYYRRGEHRRIR 404 >ref|XP_006477559.1| PREDICTED: uncharacterized protein LOC102611574 [Citrus sinensis] Length = 447 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/63 (42%), Positives = 44/63 (69%) Frame = -1 Query: 332 RIVPRCTVLEILESKGMIRRKVKVTSILALTEKKFFDKFVMKYHETIPEVMKAYKGGIEF 153 RI+PRC+VL++L S +I +T + +TEK+F ++ V KY +P+V+KA++G I+F Sbjct: 383 RILPRCSVLQLLMSNKVITEDFSLTYMFKMTEKQFIERIVKKYEHKVPKVVKAHQGKIKF 442 Query: 152 SGF 144 GF Sbjct: 443 QGF 445 >ref|XP_006440079.1| hypothetical protein CICLE_v10020122mg [Citrus clementina] gi|557542341|gb|ESR53319.1| hypothetical protein CICLE_v10020122mg [Citrus clementina] Length = 449 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/63 (42%), Positives = 44/63 (69%) Frame = -1 Query: 332 RIVPRCTVLEILESKGMIRRKVKVTSILALTEKKFFDKFVMKYHETIPEVMKAYKGGIEF 153 RI+PRC+VL++L S +I +T + +TEK+F ++ V KY +P+V+KA++G I+F Sbjct: 385 RILPRCSVLQLLMSNKVITEDFSLTYMFKMTEKQFIERIVKKYEHKVPKVVKAHQGKIKF 444 Query: 152 SGF 144 GF Sbjct: 445 QGF 447 >ref|XP_003559733.1| PREDICTED: uncharacterized protein LOC100833632 [Brachypodium distachyon] Length = 390 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/58 (53%), Positives = 45/58 (77%) Frame = -1 Query: 332 RIVPRCTVLEILESKGMIRRKVKVTSILALTEKKFFDKFVMKYHETIPEVMKAYKGGI 159 R+VPRC VL+IL SKG+IRR ++++ ++ L EKKF +K+V Y E IP+V++AY GI Sbjct: 328 RLVPRCEVLDILVSKGVIRR-IRMSHLM-LGEKKFMEKYVSNYQEAIPQVLEAYGAGI 383 >ref|XP_002278053.2| PREDICTED: uncharacterized protein LOC100264327 [Vitis vinifera] Length = 390 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/66 (40%), Positives = 46/66 (69%), Gaps = 2/66 (3%) Frame = -1 Query: 332 RIVPRCTVLEILESKGMIRRKVKVTSILALTEKKFFDKFVMKYHETIPEVMKAYKGGIEF 153 R+ PRC+V+++L KG+I++ +K+ + L L E F DK+V+KY + IP+++ Y+G + F Sbjct: 323 RVAPRCSVVKVLSLKGLIKKDLKLGTFLNLPEGDFLDKYVIKYQDEIPQLLDVYQGKVGF 382 Query: 152 --SGFG 141 GFG Sbjct: 383 VELGFG 388 >ref|XP_002271867.1| PREDICTED: uncharacterized protein LOC100263451 [Vitis vinifera] Length = 412 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/70 (41%), Positives = 45/70 (64%), Gaps = 2/70 (2%) Frame = -1 Query: 332 RIVPRCTVLEILESKGMIRRKVKVTSILALTEKKFFDKFVMKYHETIPEVMKAYKG--GI 159 RI+PRC+V +L KG++++ + + + L TEKKF D+FV+KY IP+++ +KG GI Sbjct: 337 RIIPRCSVARVLILKGLVKKDMGLGAFLRFTEKKFLDRFVIKYQNHIPQLLNLFKGEVGI 396 Query: 158 EFSGFGERRI 129 GF I Sbjct: 397 LELGFASEEI 406 >emb|CAN72401.1| hypothetical protein VITISV_012129 [Vitis vinifera] Length = 159 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/66 (40%), Positives = 46/66 (69%), Gaps = 2/66 (3%) Frame = -1 Query: 332 RIVPRCTVLEILESKGMIRRKVKVTSILALTEKKFFDKFVMKYHETIPEVMKAYKGGIEF 153 R+ PRC+V+++L KG+I++ +K+ + L L E F DK+V+KY + IP+++ Y+G + F Sbjct: 92 RVAPRCSVVKVLSLKGLIKKDLKLGTFLNLPEGDFLDKYVIKYQDEIPQLLDVYQGKVGF 151 Query: 152 --SGFG 141 GFG Sbjct: 152 VELGFG 157 >ref|XP_006363159.1| PREDICTED: uncharacterized protein LOC102589966 [Solanum tuberosum] Length = 401 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/63 (39%), Positives = 45/63 (71%) Frame = -1 Query: 332 RIVPRCTVLEILESKGMIRRKVKVTSILALTEKKFFDKFVMKYHETIPEVMKAYKGGIEF 153 R++PRC+V+++L S+G I + K++SIL ++EK F K + KY +PE++ AY+G + F Sbjct: 318 RVIPRCSVMQVLWSRGAISKVGKLSSILMISEKDFLRKCITKYEAQVPELLAAYRGELVF 377 Query: 152 SGF 144 + + Sbjct: 378 NDY 380 >ref|XP_004962127.1| PREDICTED: uncharacterized protein LOC101759700 [Setaria italica] Length = 395 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/65 (43%), Positives = 43/65 (66%) Frame = -1 Query: 329 IVPRCTVLEILESKGMIRRKVKVTSILALTEKKFFDKFVMKYHETIPEVMKAYKGGIEFS 150 I+PRC VL +L +G I RK+ + L K F +FV +Y + +P+V+KA++G I+F Sbjct: 324 IMPRCAVLSVLMREGKIERKLNLMPALLSNLKVFSARFVWRYAKDVPDVVKAFEGKIKFQ 383 Query: 149 GFGER 135 GFG+R Sbjct: 384 GFGDR 388 >ref|NP_001059486.1| Os07g0423000 [Oryza sativa Japonica Group] gi|34394750|dbj|BAC84114.1| unknown protein [Oryza sativa Japonica Group] gi|113611022|dbj|BAF21400.1| Os07g0423000 [Oryza sativa Japonica Group] gi|215766640|dbj|BAG98868.1| unnamed protein product [Oryza sativa Japonica Group] gi|222636925|gb|EEE67057.1| hypothetical protein OsJ_24009 [Oryza sativa Japonica Group] Length = 408 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/59 (52%), Positives = 41/59 (69%) Frame = -1 Query: 332 RIVPRCTVLEILESKGMIRRKVKVTSILALTEKKFFDKFVMKYHETIPEVMKAYKGGIE 156 RI+PRCTVL +L S+G+ R +K TS L L EKKF +K+V Y + IPEV++AY E Sbjct: 344 RILPRCTVLNLLASRGIFNRDIK-TSHLVLGEKKFKEKYVTPYQDEIPEVLEAYSSVAE 401