BLASTX nr result
ID: Akebia23_contig00024322
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00024322 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC41989.1| hypothetical protein L484_000662 [Morus notabilis] 67 3e-09 ref|XP_007227558.1| hypothetical protein PRUPE_ppa010640mg [Prun... 64 2e-08 ref|XP_002301184.1| hypothetical protein POPTR_0002s12760g [Popu... 62 6e-08 ref|XP_004291106.1| PREDICTED: coenzyme Q-binding protein COQ10 ... 57 3e-06 >gb|EXC41989.1| hypothetical protein L484_000662 [Morus notabilis] Length = 210 Score = 67.0 bits (162), Expect = 3e-09 Identities = 36/80 (45%), Positives = 49/80 (61%) Frame = -3 Query: 308 LSKFVGNRGKFFRVRCLSSIASIGTPPCVDKSSIDVEKDGNFTLAASLNYMQTRRFFGYG 129 L K GN GK R+RC S I I TP + DV + + ++++ +Q R F G G Sbjct: 24 LVKHAGN-GKSHRIRCFSGITGIETPLLIGSKRQDVCSSSS--ILSNVDNLQRRTFLGVG 80 Query: 128 NGDEGNVLSKIYEERRVIGY 69 +G+EG VLSK+YEERRV+GY Sbjct: 81 DGEEGGVLSKVYEERRVLGY 100 >ref|XP_007227558.1| hypothetical protein PRUPE_ppa010640mg [Prunus persica] gi|462424494|gb|EMJ28757.1| hypothetical protein PRUPE_ppa010640mg [Prunus persica] Length = 242 Score = 64.3 bits (155), Expect = 2e-08 Identities = 38/87 (43%), Positives = 50/87 (57%), Gaps = 6/87 (6%) Frame = -3 Query: 311 LLSKFVGNRG------KFFRVRCLSSIASIGTPPCVDKSSIDVEKDGNFTLAASLNYMQT 150 LLS+ +G R K+ VRC S+IA I TP + K + D D NY Sbjct: 16 LLSRRIGPRHLIRSGRKYDPVRCFSNIAGIETPSSIHKWTGDSRLD--------YNYRSR 67 Query: 149 RRFFGYGNGDEGNVLSKIYEERRVIGY 69 R+F G G+G+EG VLSK+YEE+RV+GY Sbjct: 68 RQFLGCGDGEEGGVLSKVYEEKRVLGY 94 >ref|XP_002301184.1| hypothetical protein POPTR_0002s12760g [Populus trichocarpa] gi|222842910|gb|EEE80457.1| hypothetical protein POPTR_0002s12760g [Populus trichocarpa] Length = 249 Score = 62.4 bits (150), Expect = 6e-08 Identities = 37/77 (48%), Positives = 49/77 (63%), Gaps = 3/77 (3%) Frame = -3 Query: 290 NRGKFFRVRCLSSIASIGTPPCVDKSSIDVEKDGNFTLAASLNYMQT---RRFFGYGNGD 120 N KF + RCLSS+A I P + + + + KD F LA+ Y T R F G G+G+ Sbjct: 28 NSHKFDQTRCLSSLAGI-LNPSISRGTYNNRKD--FDLASGNLYNNTTIKRGFLGCGDGE 84 Query: 119 EGNVLSKIYEERRVIGY 69 EG+VLSK+YEERRV+GY Sbjct: 85 EGSVLSKVYEERRVLGY 101 >ref|XP_004291106.1| PREDICTED: coenzyme Q-binding protein COQ10 homolog, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 251 Score = 56.6 bits (135), Expect = 3e-06 Identities = 35/70 (50%), Positives = 45/70 (64%) Frame = -3 Query: 278 FFRVRCLSSIASIGTPPCVDKSSIDVEKDGNFTLAASLNYMQTRRFFGYGNGDEGNVLSK 99 F R+R LSSIA I TP V K + D + + L + Q RRF G G+G+EG VLSK Sbjct: 36 FNRIRRLSSIAGIETPS-VRKWTGDGVSNTSRVLTNPF-HEQRRRFLGCGDGEEGGVLSK 93 Query: 98 IYEERRVIGY 69 +YEE+RV+GY Sbjct: 94 VYEEKRVLGY 103