BLASTX nr result
ID: Akebia23_contig00024213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00024213 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC06724.1| hypothetical protein L484_021563 [Morus notabilis] 57 2e-06 ref|XP_007018806.1| Uncharacterized protein TCM_034930 [Theobrom... 56 6e-06 >gb|EXC06724.1| hypothetical protein L484_021563 [Morus notabilis] Length = 349 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +2 Query: 80 YAHDFFKVSSTDIANEAWVVAGMKDPLSRSRSWKR 184 Y DF+K+SS DIANE WVV G++DPLSRSRSWKR Sbjct: 316 YDRDFYKISS-DIANETWVVGGIRDPLSRSRSWKR 349 >ref|XP_007018806.1| Uncharacterized protein TCM_034930 [Theobroma cacao] gi|508724134|gb|EOY16031.1| Uncharacterized protein TCM_034930 [Theobroma cacao] Length = 347 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 80 YAHDFFKVSSTDIANEAWVVAGMKDPLSRSRSWKR 184 Y DF+K+SS DIA E W+V GMKDPLSRSRSWKR Sbjct: 314 YDPDFYKISS-DIAKETWLVGGMKDPLSRSRSWKR 347