BLASTX nr result
ID: Akebia23_contig00024152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00024152 (274 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015393.1| Vacuolar protein sorting 26A isoform 3 [Theo... 62 6e-08 ref|XP_007015392.1| Vacuolar protein sorting 26B isoform 2 [Theo... 62 6e-08 ref|XP_007015391.1| Vacuolar protein sorting 26B isoform 1 [Theo... 62 6e-08 ref|XP_006664040.1| PREDICTED: vacuolar protein sorting-associat... 62 8e-08 ref|XP_006664039.1| PREDICTED: vacuolar protein sorting-associat... 62 8e-08 ref|XP_002532583.1| vacuolar protein sorting 26, vps26, putative... 62 1e-07 ref|XP_007220427.1| hypothetical protein PRUPE_ppa009222mg [Prun... 61 1e-07 gb|AFP55544.1| vacuolar protein sorting-associated [Rosa rugosa] 61 1e-07 ref|XP_002269444.2| PREDICTED: vacuolar protein sorting-associat... 61 1e-07 emb|CBI24336.3| unnamed protein product [Vitis vinifera] 61 1e-07 emb|CBI23055.3| unnamed protein product [Vitis vinifera] 61 1e-07 ref|XP_002274585.1| PREDICTED: vacuolar protein sorting-associat... 61 1e-07 gb|EAY83209.1| hypothetical protein OsI_38419 [Oryza sativa Indi... 61 1e-07 ref|NP_001066819.1| Os12g0500700 [Oryza sativa Japonica Group] g... 61 1e-07 gb|EYU45292.1| hypothetical protein MIMGU_mgv1a010785mg [Mimulus... 60 2e-07 ref|XP_002314237.2| hypothetical protein POPTR_0009s02630g [Popu... 60 3e-07 ref|XP_004962947.1| PREDICTED: vacuolar protein sorting-associat... 60 3e-07 ref|XP_004172721.1| PREDICTED: vacuolar protein sorting-associat... 60 3e-07 ref|XP_004144676.1| PREDICTED: vacuolar protein sorting-associat... 60 3e-07 ref|XP_006369412.1| hypothetical protein POPTR_0001s23020g [Popu... 60 3e-07 >ref|XP_007015393.1| Vacuolar protein sorting 26A isoform 3 [Theobroma cacao] gi|590585230|ref|XP_007015394.1| Vacuolar protein sorting 26A isoform 3 [Theobroma cacao] gi|508785756|gb|EOY33012.1| Vacuolar protein sorting 26A isoform 3 [Theobroma cacao] gi|508785757|gb|EOY33013.1| Vacuolar protein sorting 26A isoform 3 [Theobroma cacao] Length = 263 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 3 VKYYLNLVLVDEEDRRYFKQQEIFVYRLLET 95 VKYYLNLVLVDEEDRRYFKQQEI VYRLLET Sbjct: 233 VKYYLNLVLVDEEDRRYFKQQEITVYRLLET 263 >ref|XP_007015392.1| Vacuolar protein sorting 26B isoform 2 [Theobroma cacao] gi|508785755|gb|EOY33011.1| Vacuolar protein sorting 26B isoform 2 [Theobroma cacao] Length = 300 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 3 VKYYLNLVLVDEEDRRYFKQQEIFVYRLLET 95 VKYYLNLVLVDEEDRRYFKQQEI VYRLLET Sbjct: 270 VKYYLNLVLVDEEDRRYFKQQEITVYRLLET 300 >ref|XP_007015391.1| Vacuolar protein sorting 26B isoform 1 [Theobroma cacao] gi|508785754|gb|EOY33010.1| Vacuolar protein sorting 26B isoform 1 [Theobroma cacao] Length = 314 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 3 VKYYLNLVLVDEEDRRYFKQQEIFVYRLLET 95 VKYYLNLVLVDEEDRRYFKQQEI VYRLLET Sbjct: 284 VKYYLNLVLVDEEDRRYFKQQEITVYRLLET 314 >ref|XP_006664040.1| PREDICTED: vacuolar protein sorting-associated protein 26A-like isoform X2 [Oryza brachyantha] Length = 252 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 3 VKYYLNLVLVDEEDRRYFKQQEIFVYRLLET 95 VKYYLNLVLVDEEDRRYFKQQEI +YRLLET Sbjct: 218 VKYYLNLVLVDEEDRRYFKQQEITIYRLLET 248 >ref|XP_006664039.1| PREDICTED: vacuolar protein sorting-associated protein 26A-like isoform X1 [Oryza brachyantha] Length = 267 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 3 VKYYLNLVLVDEEDRRYFKQQEIFVYRLLET 95 VKYYLNLVLVDEEDRRYFKQQEI +YRLLET Sbjct: 233 VKYYLNLVLVDEEDRRYFKQQEITIYRLLET 263 >ref|XP_002532583.1| vacuolar protein sorting 26, vps26, putative [Ricinus communis] gi|223527692|gb|EEF29800.1| vacuolar protein sorting 26, vps26, putative [Ricinus communis] Length = 301 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 3 VKYYLNLVLVDEEDRRYFKQQEIFVYRLLETS 98 VKYYLNLVLVDEEDRRYFKQQEI +YRLLE S Sbjct: 270 VKYYLNLVLVDEEDRRYFKQQEITIYRLLENS 301 >ref|XP_007220427.1| hypothetical protein PRUPE_ppa009222mg [Prunus persica] gi|462416889|gb|EMJ21626.1| hypothetical protein PRUPE_ppa009222mg [Prunus persica] Length = 301 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 3 VKYYLNLVLVDEEDRRYFKQQEIFVYRLLETS 98 VKYYLNLVLVDEEDRRYFKQQEI +YRL ETS Sbjct: 270 VKYYLNLVLVDEEDRRYFKQQEITIYRLQETS 301 >gb|AFP55544.1| vacuolar protein sorting-associated [Rosa rugosa] Length = 301 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 3 VKYYLNLVLVDEEDRRYFKQQEIFVYRLLETS 98 VKYYLNLVLVDEEDRRYFKQQEI +YRL ETS Sbjct: 270 VKYYLNLVLVDEEDRRYFKQQEITIYRLQETS 301 >ref|XP_002269444.2| PREDICTED: vacuolar protein sorting-associated protein 26-like [Vitis vinifera] Length = 465 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 VKYYLNLVLVDEEDRRYFKQQEIFVYRLLETS 98 VKY+LNLVLVD+EDRRYFKQQEI VYRLLETS Sbjct: 434 VKYFLNLVLVDDEDRRYFKQQEITVYRLLETS 465 >emb|CBI24336.3| unnamed protein product [Vitis vinifera] Length = 332 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 VKYYLNLVLVDEEDRRYFKQQEIFVYRLLETS 98 VKY+LNLVLVD+EDRRYFKQQEI VYRLLETS Sbjct: 301 VKYFLNLVLVDDEDRRYFKQQEITVYRLLETS 332 >emb|CBI23055.3| unnamed protein product [Vitis vinifera] Length = 264 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +3 Query: 3 VKYYLNLVLVDEEDRRYFKQQEIFVYRLLETS 98 VKYYLNLVLVDEEDRRYFKQQEI VYRL ETS Sbjct: 233 VKYYLNLVLVDEEDRRYFKQQEITVYRLPETS 264 >ref|XP_002274585.1| PREDICTED: vacuolar protein sorting-associated protein 26-like [Vitis vinifera] Length = 301 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +3 Query: 3 VKYYLNLVLVDEEDRRYFKQQEIFVYRLLETS 98 VKYYLNLVLVDEEDRRYFKQQEI VYRL ETS Sbjct: 270 VKYYLNLVLVDEEDRRYFKQQEITVYRLPETS 301 >gb|EAY83209.1| hypothetical protein OsI_38419 [Oryza sativa Indica Group] Length = 306 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 3 VKYYLNLVLVDEEDRRYFKQQEIFVYRLLET 95 VKYYLNLVLVDEEDRRYFKQQEI +YRLLET Sbjct: 272 VKYYLNLVLVDEEDRRYFKQQEITMYRLLET 302 >ref|NP_001066819.1| Os12g0500700 [Oryza sativa Japonica Group] gi|108862708|gb|ABA99011.2| Vacuolar protein sorting 26, putative, expressed [Oryza sativa Japonica Group] gi|113649326|dbj|BAF29838.1| Os12g0500700 [Oryza sativa Japonica Group] gi|125579431|gb|EAZ20577.1| hypothetical protein OsJ_36186 [Oryza sativa Japonica Group] gi|215706982|dbj|BAG93442.1| unnamed protein product [Oryza sativa Japonica Group] Length = 306 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 3 VKYYLNLVLVDEEDRRYFKQQEIFVYRLLET 95 VKYYLNLVLVDEEDRRYFKQQEI +YRLLET Sbjct: 272 VKYYLNLVLVDEEDRRYFKQQEITMYRLLET 302 >gb|EYU45292.1| hypothetical protein MIMGU_mgv1a010785mg [Mimulus guttatus] Length = 301 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 3 VKYYLNLVLVDEEDRRYFKQQEIFVYRLLETS 98 VKYYLNLVLVDEEDRRYFKQQEI +YRL+E S Sbjct: 270 VKYYLNLVLVDEEDRRYFKQQEITIYRLVEAS 301 >ref|XP_002314237.2| hypothetical protein POPTR_0009s02630g [Populus trichocarpa] gi|550330895|gb|EEE88192.2| hypothetical protein POPTR_0009s02630g [Populus trichocarpa] Length = 301 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +3 Query: 3 VKYYLNLVLVDEEDRRYFKQQEIFVYRLLET 95 VKYYLNLVLVDEEDRRYFKQQEI VYRLL T Sbjct: 270 VKYYLNLVLVDEEDRRYFKQQEITVYRLLPT 300 >ref|XP_004962947.1| PREDICTED: vacuolar protein sorting-associated protein 26A-like [Setaria italica] Length = 304 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 VKYYLNLVLVDEEDRRYFKQQEIFVYRLLETS 98 VKYYLNLVLVDEEDRRYFKQQEI +YRLLE++ Sbjct: 270 VKYYLNLVLVDEEDRRYFKQQEITMYRLLESA 301 >ref|XP_004172721.1| PREDICTED: vacuolar protein sorting-associated protein 26A-like [Cucumis sativus] Length = 136 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 3 VKYYLNLVLVDEEDRRYFKQQEIFVYRLLETS 98 VKYYLNLVLVDEEDRRYFKQQEI +YRL ET+ Sbjct: 105 VKYYLNLVLVDEEDRRYFKQQEITIYRLQETT 136 >ref|XP_004144676.1| PREDICTED: vacuolar protein sorting-associated protein 26A-like [Cucumis sativus] Length = 301 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 3 VKYYLNLVLVDEEDRRYFKQQEIFVYRLLETS 98 VKYYLNLVLVDEEDRRYFKQQEI +YRL ET+ Sbjct: 270 VKYYLNLVLVDEEDRRYFKQQEITIYRLQETT 301 >ref|XP_006369412.1| hypothetical protein POPTR_0001s23020g [Populus trichocarpa] gi|118486597|gb|ABK95137.1| unknown [Populus trichocarpa] gi|118488808|gb|ABK96214.1| unknown [Populus trichocarpa x Populus deltoides] gi|550347945|gb|ERP65981.1| hypothetical protein POPTR_0001s23020g [Populus trichocarpa] Length = 301 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +3 Query: 3 VKYYLNLVLVDEEDRRYFKQQEIFVYRLLET 95 VKYYLNLVLVDEEDRRYFKQQEI VYRLL T Sbjct: 270 VKYYLNLVLVDEEDRRYFKQQEITVYRLLPT 300