BLASTX nr result
ID: Akebia23_contig00021439
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00021439 (403 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004158918.1| PREDICTED: 40S ribosomal protein S19-3-like ... 66 4e-09 ref|XP_004148892.1| PREDICTED: 40S ribosomal protein S19-3-like ... 66 4e-09 ref|XP_004141465.1| PREDICTED: 40S ribosomal protein S19-3-like ... 66 4e-09 ref|XP_002526094.1| 40S ribosomal protein S19, putative [Ricinus... 65 1e-08 ref|XP_002305397.1| 40S ribosomal protein S19 [Populus trichocar... 65 1e-08 ref|XP_006431274.1| hypothetical protein CICLE_v10013054mg [Citr... 64 2e-08 ref|XP_002526095.1| 40S ribosomal protein S19-3, putative [Ricin... 64 2e-08 ref|XP_002323893.1| 40S ribosomal protein S19 [Populus trichocar... 64 2e-08 ref|XP_004489501.1| PREDICTED: 40S ribosomal protein S19-1-like ... 63 5e-08 ref|XP_007215969.1| hypothetical protein PRUPE_ppa011540mg [Prun... 63 5e-08 ref|XP_007148840.1| hypothetical protein PHAVU_005G018600g [Phas... 62 1e-07 ref|XP_007146051.1| hypothetical protein PHAVU_006G008700g [Phas... 62 1e-07 ref|XP_002521219.1| 40S ribosomal protein S19, putative [Ricinus... 61 1e-07 ref|NP_001236216.1| uncharacterized protein LOC100499800 [Glycin... 60 2e-07 emb|CAA10125.1| 40S ribosomal protein S19 [Cicer arietinum] 60 3e-07 ref|XP_004516579.1| PREDICTED: 40S ribosomal protein S19-1-like ... 60 3e-07 ref|NP_001275229.1| 40S ribosomal protein S19-like [Solanum tube... 60 4e-07 ref|XP_007022688.1| Ribosomal protein S19e family protein isofor... 59 5e-07 ref|XP_006650205.1| PREDICTED: 40S ribosomal protein S19-like [O... 59 7e-07 ref|XP_006408450.1| hypothetical protein EUTSA_v10022439mg [Eutr... 59 7e-07 >ref|XP_004158918.1| PREDICTED: 40S ribosomal protein S19-3-like [Cucumis sativus] Length = 143 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 4 MNIIDIDPKGGRRITSTGRRDLDQVAGRIVVAP 102 MNI+D+DPKGGRRITS+GRRDLDQVAGRIVVAP Sbjct: 111 MNIVDVDPKGGRRITSSGRRDLDQVAGRIVVAP 143 >ref|XP_004148892.1| PREDICTED: 40S ribosomal protein S19-3-like [Cucumis sativus] Length = 143 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 4 MNIIDIDPKGGRRITSTGRRDLDQVAGRIVVAP 102 MNI+D+DPKGGRRITS+GRRDLDQVAGRIVVAP Sbjct: 111 MNIVDVDPKGGRRITSSGRRDLDQVAGRIVVAP 143 >ref|XP_004141465.1| PREDICTED: 40S ribosomal protein S19-3-like [Cucumis sativus] gi|449481377|ref|XP_004156165.1| PREDICTED: 40S ribosomal protein S19-3-like [Cucumis sativus] Length = 143 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 4 MNIIDIDPKGGRRITSTGRRDLDQVAGRIVVAP 102 MNI+D+DPKGGRRITS+GRRDLDQVAGRIVVAP Sbjct: 111 MNIVDVDPKGGRRITSSGRRDLDQVAGRIVVAP 143 >ref|XP_002526094.1| 40S ribosomal protein S19, putative [Ricinus communis] gi|223534591|gb|EEF36288.1| 40S ribosomal protein S19, putative [Ricinus communis] Length = 143 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 4 MNIIDIDPKGGRRITSTGRRDLDQVAGRIVVAP 102 MNI+DIDPKGGRRITS+G+RDLDQVAGRIVVAP Sbjct: 111 MNIVDIDPKGGRRITSSGQRDLDQVAGRIVVAP 143 >ref|XP_002305397.1| 40S ribosomal protein S19 [Populus trichocarpa] gi|222848361|gb|EEE85908.1| 40S ribosomal protein S19 [Populus trichocarpa] Length = 143 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 4 MNIIDIDPKGGRRITSTGRRDLDQVAGRIVVAP 102 MNIID+DPKGGRRITS+G+RDLDQVAGRIVVAP Sbjct: 111 MNIIDVDPKGGRRITSSGQRDLDQVAGRIVVAP 143 >ref|XP_006431274.1| hypothetical protein CICLE_v10013054mg [Citrus clementina] gi|568858379|ref|XP_006482731.1| PREDICTED: 40S ribosomal protein S19-3-like [Citrus sinensis] gi|557533331|gb|ESR44514.1| hypothetical protein CICLE_v10013054mg [Citrus clementina] Length = 143 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 4 MNIIDIDPKGGRRITSTGRRDLDQVAGRIVVAP 102 MNIIDI+PKGGRRITS+G+RDLDQVAGRIVVAP Sbjct: 111 MNIIDIEPKGGRRITSSGQRDLDQVAGRIVVAP 143 >ref|XP_002526095.1| 40S ribosomal protein S19-3, putative [Ricinus communis] gi|223534592|gb|EEF36289.1| 40S ribosomal protein S19-3, putative [Ricinus communis] Length = 143 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +1 Query: 4 MNIIDIDPKGGRRITSTGRRDLDQVAGRIVVAP 102 MNI+DIDPKGGR+ITS+G+RDLDQVAGRIVVAP Sbjct: 111 MNIVDIDPKGGRKITSSGQRDLDQVAGRIVVAP 143 >ref|XP_002323893.1| 40S ribosomal protein S19 [Populus trichocarpa] gi|118487378|gb|ABK95517.1| unknown [Populus trichocarpa] gi|222866895|gb|EEF04026.1| 40S ribosomal protein S19 [Populus trichocarpa] Length = 143 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 4 MNIIDIDPKGGRRITSTGRRDLDQVAGRIVVAP 102 +NIIDIDPKGGRRITS+G+RDLDQVAGRIVVAP Sbjct: 111 VNIIDIDPKGGRRITSSGQRDLDQVAGRIVVAP 143 >ref|XP_004489501.1| PREDICTED: 40S ribosomal protein S19-1-like [Cicer arietinum] Length = 143 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = +1 Query: 4 MNIIDIDPKGGRRITSTGRRDLDQVAGRIVVAP 102 MNII++DPKGGR++TS+GRRDLDQVAGRIV+AP Sbjct: 111 MNIIEVDPKGGRKLTSSGRRDLDQVAGRIVIAP 143 >ref|XP_007215969.1| hypothetical protein PRUPE_ppa011540mg [Prunus persica] gi|462412119|gb|EMJ17168.1| hypothetical protein PRUPE_ppa011540mg [Prunus persica] Length = 206 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 4 MNIIDIDPKGGRRITSTGRRDLDQVAGRIVVAP 102 MNI+D+DPKGGRRITS+G+RDLDQVAGRIVV P Sbjct: 174 MNIVDLDPKGGRRITSSGQRDLDQVAGRIVVTP 206 >ref|XP_007148840.1| hypothetical protein PHAVU_005G018600g [Phaseolus vulgaris] gi|561022104|gb|ESW20834.1| hypothetical protein PHAVU_005G018600g [Phaseolus vulgaris] Length = 143 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 1 TMNIIDIDPKGGRRITSTGRRDLDQVAGRIVVAP 102 TMNII++D KGGRRIT +GRRDLDQVAGRIVVAP Sbjct: 110 TMNIIELDTKGGRRITPSGRRDLDQVAGRIVVAP 143 >ref|XP_007146051.1| hypothetical protein PHAVU_006G008700g [Phaseolus vulgaris] gi|561019274|gb|ESW18045.1| hypothetical protein PHAVU_006G008700g [Phaseolus vulgaris] Length = 143 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +1 Query: 1 TMNIIDIDPKGGRRITSTGRRDLDQVAGRIVVAP 102 TM+II++D KGGRRITS+GRRDLDQVAGRIVVAP Sbjct: 110 TMSIIELDTKGGRRITSSGRRDLDQVAGRIVVAP 143 >ref|XP_002521219.1| 40S ribosomal protein S19, putative [Ricinus communis] gi|223539584|gb|EEF41171.1| 40S ribosomal protein S19, putative [Ricinus communis] Length = 143 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 4 MNIIDIDPKGGRRITSTGRRDLDQVAGRIVVAP 102 MNI+DID KGGRRITSTG+RDLDQVAG I+VAP Sbjct: 111 MNIVDIDSKGGRRITSTGQRDLDQVAGHIIVAP 143 >ref|NP_001236216.1| uncharacterized protein LOC100499800 [Glycine max] gi|255626719|gb|ACU13704.1| unknown [Glycine max] Length = 143 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 4 MNIIDIDPKGGRRITSTGRRDLDQVAGRIVVAP 102 MNII++D KGGR+ITS+GRRDLDQVAGRIVVAP Sbjct: 111 MNIIELDTKGGRKITSSGRRDLDQVAGRIVVAP 143 >emb|CAA10125.1| 40S ribosomal protein S19 [Cicer arietinum] Length = 105 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 4 MNIIDIDPKGGRRITSTGRRDLDQVAGRIVVAP 102 MNII++D KGGR+ITS+GRRDLDQVAGRIVVAP Sbjct: 73 MNIIEMDTKGGRKITSSGRRDLDQVAGRIVVAP 105 >ref|XP_004516579.1| PREDICTED: 40S ribosomal protein S19-1-like [Cicer arietinum] Length = 143 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 4 MNIIDIDPKGGRRITSTGRRDLDQVAGRIVVAP 102 MNII++D KGGR+ITS+GRRDLDQVAGRIVVAP Sbjct: 111 MNIIEMDTKGGRKITSSGRRDLDQVAGRIVVAP 143 >ref|NP_001275229.1| 40S ribosomal protein S19-like [Solanum tuberosum] gi|82623403|gb|ABB87116.1| 40S ribosomal protein S19-like [Solanum tuberosum] Length = 143 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 1 TMNIIDIDPKGGRRITSTGRRDLDQVAGRIVVA 99 TMNIID DPKGGRRITS G+RDLDQVAGRI A Sbjct: 110 TMNIIDFDPKGGRRITSNGQRDLDQVAGRITAA 142 >ref|XP_007022688.1| Ribosomal protein S19e family protein isoform 1 [Theobroma cacao] gi|508722316|gb|EOY14213.1| Ribosomal protein S19e family protein isoform 1 [Theobroma cacao] Length = 143 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 4 MNIIDIDPKGGRRITSTGRRDLDQVAGRIVVA 99 +NIIDIDPKGGRRITS G+RDLDQVAGRI VA Sbjct: 111 VNIIDIDPKGGRRITSNGQRDLDQVAGRIAVA 142 >ref|XP_006650205.1| PREDICTED: 40S ribosomal protein S19-like [Oryza brachyantha] Length = 145 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 4 MNIIDIDPKGGRRITSTGRRDLDQVAGRIVVAP 102 M IID+DPKGGR ITS GRRDLDQVAGR+ VAP Sbjct: 113 MGIIDVDPKGGRLITSQGRRDLDQVAGRVAVAP 145 >ref|XP_006408450.1| hypothetical protein EUTSA_v10022439mg [Eutrema salsugineum] gi|557109596|gb|ESQ49903.1| hypothetical protein EUTSA_v10022439mg [Eutrema salsugineum] Length = 143 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 TMNIIDIDPKGGRRITSTGRRDLDQVAGRIVVAP 102 TMNI++ID KGGRRITS+G+RDLDQVAGRI V P Sbjct: 110 TMNIVEIDTKGGRRITSSGQRDLDQVAGRIAVEP 143