BLASTX nr result
ID: Akebia23_contig00021437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00021437 (598 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32300.3| unnamed protein product [Vitis vinifera] 75 1e-11 ref|XP_002271734.1| PREDICTED: LEC14B homolog [Vitis vinifera] 75 1e-11 ref|XP_002524772.1| LEC14B protein, putative [Ricinus communis] ... 75 1e-11 ref|XP_006396529.1| hypothetical protein EUTSA_v10028659mg [Eutr... 74 4e-11 ref|XP_006287594.1| hypothetical protein CARUB_v10000807mg [Caps... 74 4e-11 ref|XP_004158926.1| PREDICTED: LOW QUALITY PROTEIN: LEC14B homol... 74 4e-11 ref|XP_004148877.1| PREDICTED: LEC14B homolog [Cucumis sativus] 74 4e-11 sp|O24467.1|LE14B_PRUAR RecName: Full=LEC14B homolog gi|2351587|... 73 5e-11 ref|XP_004290703.1| PREDICTED: LEC14B protein-like [Fragaria ves... 73 7e-11 ref|XP_002320381.2| transducin family protein [Populus trichocar... 72 1e-10 ref|XP_007225716.1| hypothetical protein PRUPE_ppa005101mg [Prun... 72 1e-10 ref|XP_007225715.1| hypothetical protein PRUPE_ppa005101mg [Prun... 72 1e-10 ref|XP_002516837.1| LEC14B protein, putative [Ricinus communis] ... 72 1e-10 ref|XP_002315545.1| LEC14B family protein [Populus trichocarpa] ... 72 1e-10 ref|XP_006588492.1| PREDICTED: uncharacterized protein LOC100815... 72 2e-10 ref|NP_001239957.1| uncharacterized protein LOC100815163 [Glycin... 72 2e-10 ref|XP_003591600.1| LEC14B protein, partial [Medicago truncatula... 71 3e-10 ref|XP_003591588.1| LEC14B protein [Medicago truncatula] gi|3554... 71 3e-10 gb|EXC34653.1| LEC14B protein [Morus notabilis] 70 3e-10 ref|XP_004496055.1| PREDICTED: LOW QUALITY PROTEIN: LEC14B prote... 70 3e-10 >emb|CBI32300.3| unnamed protein product [Vitis vinifera] Length = 365 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +2 Query: 200 KGNHNRIYNVDDGWTVQKDILAKSLRWTVTDTTLSPDQRHL 322 +G+H RIYNVD GW VQK+ILAKSLRWTVTDT+LSPDQRHL Sbjct: 22 QGSHIRIYNVDRGWKVQKNILAKSLRWTVTDTSLSPDQRHL 62 >ref|XP_002271734.1| PREDICTED: LEC14B homolog [Vitis vinifera] Length = 486 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +2 Query: 200 KGNHNRIYNVDDGWTVQKDILAKSLRWTVTDTTLSPDQRHL 322 +G+H RIYNVD GW VQK+ILAKSLRWTVTDT+LSPDQRHL Sbjct: 143 QGSHIRIYNVDRGWKVQKNILAKSLRWTVTDTSLSPDQRHL 183 >ref|XP_002524772.1| LEC14B protein, putative [Ricinus communis] gi|223535956|gb|EEF37615.1| LEC14B protein, putative [Ricinus communis] Length = 437 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +2 Query: 200 KGNHNRIYNVDDGWTVQKDILAKSLRWTVTDTTLSPDQRHL 322 +G+H RIYNVD GW VQK+ILAKSLRWTVTDT+LSPDQRHL Sbjct: 131 QGSHIRIYNVDRGWKVQKNILAKSLRWTVTDTSLSPDQRHL 171 >ref|XP_006396529.1| hypothetical protein EUTSA_v10028659mg [Eutrema salsugineum] gi|567161693|ref|XP_006396530.1| hypothetical protein EUTSA_v10028659mg [Eutrema salsugineum] gi|557097546|gb|ESQ37982.1| hypothetical protein EUTSA_v10028659mg [Eutrema salsugineum] gi|557097547|gb|ESQ37983.1| hypothetical protein EUTSA_v10028659mg [Eutrema salsugineum] Length = 442 Score = 73.6 bits (179), Expect = 4e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +2 Query: 200 KGNHNRIYNVDDGWTVQKDILAKSLRWTVTDTTLSPDQRHL 322 +G+H RIYNV+ GW VQKDILAKSLRWTVTDT+LSPDQR+L Sbjct: 98 QGSHIRIYNVEKGWKVQKDILAKSLRWTVTDTSLSPDQRNL 138 >ref|XP_006287594.1| hypothetical protein CARUB_v10000807mg [Capsella rubella] gi|565459192|ref|XP_006287595.1| hypothetical protein CARUB_v10000807mg [Capsella rubella] gi|482556300|gb|EOA20492.1| hypothetical protein CARUB_v10000807mg [Capsella rubella] gi|482556301|gb|EOA20493.1| hypothetical protein CARUB_v10000807mg [Capsella rubella] Length = 493 Score = 73.6 bits (179), Expect = 4e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +2 Query: 200 KGNHNRIYNVDDGWTVQKDILAKSLRWTVTDTTLSPDQRHL 322 +G+H RIYNV+ GW VQKDILAKSLRWTVTDT+LSPDQR+L Sbjct: 146 QGSHIRIYNVEKGWKVQKDILAKSLRWTVTDTSLSPDQRNL 186 >ref|XP_004158926.1| PREDICTED: LOW QUALITY PROTEIN: LEC14B homolog [Cucumis sativus] Length = 488 Score = 73.6 bits (179), Expect = 4e-11 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = +2 Query: 200 KGNHNRIYNVDDGWTVQKDILAKSLRWTVTDTTLSPDQRHL 322 +G+H RIYNVD GW VQK+ILAKSLRWT+TDT+LSPDQR+L Sbjct: 142 QGSHIRIYNVDSGWKVQKNILAKSLRWTITDTSLSPDQRYL 182 >ref|XP_004148877.1| PREDICTED: LEC14B homolog [Cucumis sativus] Length = 488 Score = 73.6 bits (179), Expect = 4e-11 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = +2 Query: 200 KGNHNRIYNVDDGWTVQKDILAKSLRWTVTDTTLSPDQRHL 322 +G+H RIYNVD GW VQK+ILAKSLRWT+TDT+LSPDQR+L Sbjct: 142 QGSHIRIYNVDSGWKVQKNILAKSLRWTITDTSLSPDQRYL 182 >sp|O24467.1|LE14B_PRUAR RecName: Full=LEC14B homolog gi|2351587|gb|AAB88274.1| LEC14B homolog [Prunus armeniaca] Length = 475 Score = 73.2 bits (178), Expect = 5e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +2 Query: 200 KGNHNRIYNVDDGWTVQKDILAKSLRWTVTDTTLSPDQRHL 322 +G H RIYNVD GW VQKDIL KSLRWT+TDT+LSPDQR+L Sbjct: 130 QGGHIRIYNVDKGWKVQKDILTKSLRWTITDTSLSPDQRYL 170 >ref|XP_004290703.1| PREDICTED: LEC14B protein-like [Fragaria vesca subsp. vesca] Length = 491 Score = 72.8 bits (177), Expect = 7e-11 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +2 Query: 200 KGNHNRIYNVDDGWTVQKDILAKSLRWTVTDTTLSPDQRHL 322 +G+H +IYNVD GW VQKDI AK+LRWTVTDT+LSPDQRHL Sbjct: 140 QGSHIKIYNVDKGWKVQKDIHAKNLRWTVTDTSLSPDQRHL 180 >ref|XP_002320381.2| transducin family protein [Populus trichocarpa] gi|550324105|gb|EEE98696.2| transducin family protein [Populus trichocarpa] Length = 483 Score = 72.0 bits (175), Expect = 1e-10 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = +2 Query: 200 KGNHNRIYNVDDGWTVQKDILAKSLRWTVTDTTLSPDQRHL 322 +G++ RIYNV+ GW VQK+ILAKSLRWTVTDT+LSPDQRHL Sbjct: 131 QGSYIRIYNVEKGWKVQKNILAKSLRWTVTDTSLSPDQRHL 171 >ref|XP_007225716.1| hypothetical protein PRUPE_ppa005101mg [Prunus persica] gi|462422652|gb|EMJ26915.1| hypothetical protein PRUPE_ppa005101mg [Prunus persica] Length = 477 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +2 Query: 200 KGNHNRIYNVDDGWTVQKDILAKSLRWTVTDTTLSPDQRHL 322 +G H +IYNVD GW VQKDIL KSLRWT+TDT+LSPDQR+L Sbjct: 130 QGGHIKIYNVDKGWKVQKDILTKSLRWTITDTSLSPDQRYL 170 >ref|XP_007225715.1| hypothetical protein PRUPE_ppa005101mg [Prunus persica] gi|462422651|gb|EMJ26914.1| hypothetical protein PRUPE_ppa005101mg [Prunus persica] Length = 476 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +2 Query: 200 KGNHNRIYNVDDGWTVQKDILAKSLRWTVTDTTLSPDQRHL 322 +G H +IYNVD GW VQKDIL KSLRWT+TDT+LSPDQR+L Sbjct: 130 QGGHIKIYNVDKGWKVQKDILTKSLRWTITDTSLSPDQRYL 170 >ref|XP_002516837.1| LEC14B protein, putative [Ricinus communis] gi|223543925|gb|EEF45451.1| LEC14B protein, putative [Ricinus communis] Length = 478 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +2 Query: 200 KGNHNRIYNVDDGWTVQKDILAKSLRWTVTDTTLSPDQRHL 322 +G H R+YNVD GW VQKDIL KSLRWT+TDT LSPDQR+L Sbjct: 129 QGGHIRVYNVDKGWKVQKDILTKSLRWTITDTCLSPDQRYL 169 >ref|XP_002315545.1| LEC14B family protein [Populus trichocarpa] gi|222864585|gb|EEF01716.1| LEC14B family protein [Populus trichocarpa] Length = 474 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +2 Query: 200 KGNHNRIYNVDDGWTVQKDILAKSLRWTVTDTTLSPDQRHL 322 +G+H RIYNVD GW +QKDILAKSLRWT+TDT LSP+QR+L Sbjct: 127 QGSHIRIYNVDKGWKIQKDILAKSLRWTITDTCLSPNQRYL 167 >ref|XP_006588492.1| PREDICTED: uncharacterized protein LOC100815163 isoform X1 [Glycine max] Length = 467 Score = 71.6 bits (174), Expect = 2e-10 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = +2 Query: 200 KGNHNRIYNVDDGWTVQKDILAKSLRWTVTDTTLSPDQRHL 322 +G+H RIYNVD GW VQK+ILAK+LRWT+TDT+LSPDQR+L Sbjct: 143 QGSHIRIYNVDRGWKVQKNILAKNLRWTITDTSLSPDQRYL 183 >ref|NP_001239957.1| uncharacterized protein LOC100815163 [Glycine max] gi|255636711|gb|ACU18691.1| unknown [Glycine max] Length = 493 Score = 71.6 bits (174), Expect = 2e-10 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = +2 Query: 200 KGNHNRIYNVDDGWTVQKDILAKSLRWTVTDTTLSPDQRHL 322 +G+H RIYNVD GW VQK+ILAK+LRWT+TDT+LSPDQR+L Sbjct: 143 QGSHIRIYNVDRGWKVQKNILAKNLRWTITDTSLSPDQRYL 183 >ref|XP_003591600.1| LEC14B protein, partial [Medicago truncatula] gi|355480648|gb|AES61851.1| LEC14B protein, partial [Medicago truncatula] Length = 321 Score = 70.9 bits (172), Expect = 3e-10 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +2 Query: 200 KGNHNRIYNVDDGWTVQKDILAKSLRWTVTDTTLSPDQRHL 322 +GNH +IYNV+ GW VQK+IL KSLRWT+TDT+LSPDQ HL Sbjct: 143 QGNHIKIYNVEKGWKVQKNILTKSLRWTITDTSLSPDQSHL 183 >ref|XP_003591588.1| LEC14B protein [Medicago truncatula] gi|355480636|gb|AES61839.1| LEC14B protein [Medicago truncatula] Length = 495 Score = 70.9 bits (172), Expect = 3e-10 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +2 Query: 200 KGNHNRIYNVDDGWTVQKDILAKSLRWTVTDTTLSPDQRHL 322 +GNH +IYNV+ GW VQK+IL KSLRWT+TDT+LSPDQ HL Sbjct: 143 QGNHIKIYNVEKGWKVQKNILTKSLRWTITDTSLSPDQSHL 183 >gb|EXC34653.1| LEC14B protein [Morus notabilis] Length = 487 Score = 70.5 bits (171), Expect = 3e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +2 Query: 200 KGNHNRIYNVDDGWTVQKDILAKSLRWTVTDTTLSPDQRHL 322 +G+H RIYNVD GW V+K+ILAKSLRWT+TDT+LS DQRHL Sbjct: 143 QGSHIRIYNVDRGWKVRKNILAKSLRWTITDTSLSSDQRHL 183 >ref|XP_004496055.1| PREDICTED: LOW QUALITY PROTEIN: LEC14B protein-like [Cicer arietinum] Length = 493 Score = 70.5 bits (171), Expect = 3e-10 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +2 Query: 200 KGNHNRIYNVDDGWTVQKDILAKSLRWTVTDTTLSPDQRHL 322 +GNH +IYNVD GW VQK+IL KSLRWT+TDT+LSPDQ +L Sbjct: 143 QGNHIKIYNVDKGWKVQKNILTKSLRWTITDTSLSPDQHYL 183