BLASTX nr result
ID: Akebia23_contig00021241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00021241 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS87234.1| hypothetical protein PFICI_01062 [Pestalotiopsis ... 71 2e-10 >gb|ETS87234.1| hypothetical protein PFICI_01062 [Pestalotiopsis fici W106-1] Length = 173 Score = 70.9 bits (172), Expect = 2e-10 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = +1 Query: 67 EPDIKTSLNGLVAREADFRSAGVASLVLAQLNTLKTDQDSYGATLLSKTS 216 EPDIK SL+ LVAREADF S GVA++VL+QL TLK+ D+YGATLLS TS Sbjct: 98 EPDIKASLDALVAREADFESVGVAAVVLSQLQTLKSKTDAYGATLLSITS 147