BLASTX nr result
ID: Akebia23_contig00021234
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00021234 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004168907.1| PREDICTED: pentatricopeptide repeat-containi... 112 4e-23 ref|XP_004147126.1| PREDICTED: pentatricopeptide repeat-containi... 112 4e-23 ref|XP_004308197.1| PREDICTED: pentatricopeptide repeat-containi... 112 5e-23 ref|XP_007220255.1| hypothetical protein PRUPE_ppa001444mg [Prun... 112 5e-23 ref|NP_172596.1| pentatricopeptide repeat-containing protein [Ar... 112 7e-23 ref|XP_004499782.1| PREDICTED: pentatricopeptide repeat-containi... 111 9e-23 ref|XP_002892635.1| pentatricopeptide repeat-containing protein ... 111 9e-23 ref|XP_007010747.1| Pentatricopeptide repeat (PPR) superfamily p... 110 2e-22 ref|XP_007148793.1| hypothetical protein PHAVU_005G014800g [Phas... 109 5e-22 ref|XP_006393717.1| hypothetical protein EUTSA_v10011247mg [Eutr... 108 8e-22 ref|XP_003523921.1| PREDICTED: pentatricopeptide repeat-containi... 108 8e-22 emb|CBI40653.3| unnamed protein product [Vitis vinifera] 108 8e-22 ref|XP_002272111.1| PREDICTED: pentatricopeptide repeat-containi... 108 8e-22 gb|EYU40350.1| hypothetical protein MIMGU_mgv1a021272mg [Mimulus... 108 1e-21 gb|EXB44298.1| hypothetical protein L484_012217 [Morus notabilis] 107 1e-21 ref|XP_007148792.1| hypothetical protein PHAVU_005G014700g [Phas... 107 2e-21 ref|XP_006304494.1| hypothetical protein CARUB_v10011264mg [Caps... 107 2e-21 ref|XP_003526349.1| PREDICTED: pentatricopeptide repeat-containi... 106 4e-21 ref|XP_006432351.1| hypothetical protein CICLE_v10000307mg [Citr... 103 2e-20 ref|XP_006347159.1| PREDICTED: pentatricopeptide repeat-containi... 103 3e-20 >ref|XP_004168907.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Cucumis sativus] Length = 821 Score = 112 bits (281), Expect = 4e-23 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +1 Query: 1 TIHLRKNLRVCGDCHNATKYISLVTGREIVVRDMQRFHHFKNGSCSCGDYW 153 TIH+RKNLRVCGDCHNATKYISLVTGREI+VRDMQRFHHFKNG CSCGDYW Sbjct: 771 TIHVRKNLRVCGDCHNATKYISLVTGREIIVRDMQRFHHFKNGICSCGDYW 821 >ref|XP_004147126.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Cucumis sativus] Length = 821 Score = 112 bits (281), Expect = 4e-23 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +1 Query: 1 TIHLRKNLRVCGDCHNATKYISLVTGREIVVRDMQRFHHFKNGSCSCGDYW 153 TIH+RKNLRVCGDCHNATKYISLVTGREI+VRDMQRFHHFKNG CSCGDYW Sbjct: 771 TIHVRKNLRVCGDCHNATKYISLVTGREIIVRDMQRFHHFKNGICSCGDYW 821 >ref|XP_004308197.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Fragaria vesca subsp. vesca] Length = 827 Score = 112 bits (280), Expect = 5e-23 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +1 Query: 1 TIHLRKNLRVCGDCHNATKYISLVTGREIVVRDMQRFHHFKNGSCSCGDYW 153 TIH+RKNLRVCGDCHNATKYISLVTGREI+VRDM RFHHFKNG+CSCGDYW Sbjct: 777 TIHIRKNLRVCGDCHNATKYISLVTGREIIVRDMHRFHHFKNGTCSCGDYW 827 >ref|XP_007220255.1| hypothetical protein PRUPE_ppa001444mg [Prunus persica] gi|462416717|gb|EMJ21454.1| hypothetical protein PRUPE_ppa001444mg [Prunus persica] Length = 827 Score = 112 bits (280), Expect = 5e-23 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +1 Query: 1 TIHLRKNLRVCGDCHNATKYISLVTGREIVVRDMQRFHHFKNGSCSCGDYW 153 TIH+RKNLRVCGDCHNATKYISLVTGREI+VRDM RFHHFKNG+CSCGDYW Sbjct: 777 TIHIRKNLRVCGDCHNATKYISLVTGREIIVRDMHRFHHFKNGTCSCGDYW 827 >ref|NP_172596.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122213654|sp|Q3E6Q1.1|PPR32_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g11290 gi|332190592|gb|AEE28713.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 809 Score = 112 bits (279), Expect = 7e-23 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +1 Query: 1 TIHLRKNLRVCGDCHNATKYISLVTGREIVVRDMQRFHHFKNGSCSCGDYW 153 TIH+RKNLRVC DCHNATKYISLVTGREIVVRDMQRFHHFKNG+CSCGDYW Sbjct: 759 TIHVRKNLRVCADCHNATKYISLVTGREIVVRDMQRFHHFKNGACSCGDYW 809 >ref|XP_004499782.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Cicer arietinum] Length = 814 Score = 111 bits (278), Expect = 9e-23 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +1 Query: 1 TIHLRKNLRVCGDCHNATKYISLVTGREIVVRDMQRFHHFKNGSCSCGDYW 153 TIH+RKNLRVCGDCH ATKYISLVTGREI+VRD+QRFHHFKNGSCSCGDYW Sbjct: 764 TIHVRKNLRVCGDCHEATKYISLVTGREIIVRDLQRFHHFKNGSCSCGDYW 814 >ref|XP_002892635.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297338477|gb|EFH68894.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 809 Score = 111 bits (278), Expect = 9e-23 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +1 Query: 1 TIHLRKNLRVCGDCHNATKYISLVTGREIVVRDMQRFHHFKNGSCSCGDYW 153 TIH+RKNLRVC DCHNATKYISLVTGREI+VRDMQRFHHFKNG+CSCGDYW Sbjct: 759 TIHVRKNLRVCADCHNATKYISLVTGREIIVRDMQRFHHFKNGACSCGDYW 809 >ref|XP_007010747.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508727660|gb|EOY19557.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 886 Score = 110 bits (275), Expect = 2e-22 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +1 Query: 4 IHLRKNLRVCGDCHNATKYISLVTGREIVVRDMQRFHHFKNGSCSCGDYW 153 IH+RKNLRVCGDCHNATKYISLVTGREI+VRDM RFHHFKNG+CSCGDYW Sbjct: 837 IHIRKNLRVCGDCHNATKYISLVTGREIIVRDMHRFHHFKNGTCSCGDYW 886 >ref|XP_007148793.1| hypothetical protein PHAVU_005G014800g [Phaseolus vulgaris] gi|561022057|gb|ESW20787.1| hypothetical protein PHAVU_005G014800g [Phaseolus vulgaris] Length = 807 Score = 109 bits (272), Expect = 5e-22 Identities = 45/51 (88%), Positives = 50/51 (98%) Frame = +1 Query: 1 TIHLRKNLRVCGDCHNATKYISLVTGREIVVRDMQRFHHFKNGSCSCGDYW 153 TIH+RKNLRVCGDCH ATKYISLVTGREI+VRD++RFHHFKNG+CSCGDYW Sbjct: 757 TIHIRKNLRVCGDCHEATKYISLVTGREIIVRDLRRFHHFKNGNCSCGDYW 807 >ref|XP_006393717.1| hypothetical protein EUTSA_v10011247mg [Eutrema salsugineum] gi|557090295|gb|ESQ31003.1| hypothetical protein EUTSA_v10011247mg [Eutrema salsugineum] Length = 807 Score = 108 bits (270), Expect = 8e-22 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +1 Query: 1 TIHLRKNLRVCGDCHNATKYISLVTGREIVVRDMQRFHHFKNGSCSCGDYW 153 TIH+RKNLRVC DCHNATKYISLVTGREI+VRDMQRFHHFK G+CSCGDYW Sbjct: 757 TIHVRKNLRVCADCHNATKYISLVTGREIIVRDMQRFHHFKYGACSCGDYW 807 >ref|XP_003523921.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Glycine max] Length = 818 Score = 108 bits (270), Expect = 8e-22 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = +1 Query: 1 TIHLRKNLRVCGDCHNATKYISLVTGREIVVRDMQRFHHFKNGSCSCGDYW 153 T+H+RKNLRVCGDCH+ TKYISLVTGREI+VRD++RFHHFKNGSCSCGDYW Sbjct: 768 TLHIRKNLRVCGDCHDTTKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 818 >emb|CBI40653.3| unnamed protein product [Vitis vinifera] Length = 597 Score = 108 bits (270), Expect = 8e-22 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = +1 Query: 1 TIHLRKNLRVCGDCHNATKYISLVTGREIVVRDMQRFHHFKNGSCSCGDYW 153 TIHLRKNLRVCGDCHNATKYISLVT REI+VRDM+RFHHFK+G+CSCGDYW Sbjct: 547 TIHLRKNLRVCGDCHNATKYISLVTKREIIVRDMRRFHHFKDGTCSCGDYW 597 >ref|XP_002272111.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Vitis vinifera] Length = 849 Score = 108 bits (270), Expect = 8e-22 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = +1 Query: 1 TIHLRKNLRVCGDCHNATKYISLVTGREIVVRDMQRFHHFKNGSCSCGDYW 153 TIHLRKNLRVCGDCHNATKYISLVT REI+VRDM+RFHHFK+G+CSCGDYW Sbjct: 799 TIHLRKNLRVCGDCHNATKYISLVTKREIIVRDMRRFHHFKDGTCSCGDYW 849 >gb|EYU40350.1| hypothetical protein MIMGU_mgv1a021272mg [Mimulus guttatus] Length = 791 Score = 108 bits (269), Expect = 1e-21 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = +1 Query: 1 TIHLRKNLRVCGDCHNATKYISLVTGREIVVRDMQRFHHFKNGSCSCGDYW 153 TIH+RKNLRVCGDCHNATKYISLVT REI+VRDM RFHHFKNG CSCGDYW Sbjct: 741 TIHIRKNLRVCGDCHNATKYISLVTEREIIVRDMHRFHHFKNGVCSCGDYW 791 >gb|EXB44298.1| hypothetical protein L484_012217 [Morus notabilis] Length = 814 Score = 107 bits (268), Expect = 1e-21 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +1 Query: 1 TIHLRKNLRVCGDCHNATKYISLVTGREIVVRDMQRFHHFKNGSCSCGDYW 153 TIH+RKNLRVCGDCHNATKYISLV+GREI+VRDM RFH FKNG+CSCGDYW Sbjct: 764 TIHIRKNLRVCGDCHNATKYISLVSGREIIVRDMHRFHQFKNGTCSCGDYW 814 >ref|XP_007148792.1| hypothetical protein PHAVU_005G014700g [Phaseolus vulgaris] gi|561022056|gb|ESW20786.1| hypothetical protein PHAVU_005G014700g [Phaseolus vulgaris] Length = 814 Score = 107 bits (267), Expect = 2e-21 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +1 Query: 1 TIHLRKNLRVCGDCHNATKYISLVTGREIVVRDMQRFHHFKNGSCSCGDYW 153 TIH+RKNLRVCGDCH ATKYISLVTGREI+VRD++RFHHFKNGSCSC DYW Sbjct: 764 TIHIRKNLRVCGDCHEATKYISLVTGREIIVRDLRRFHHFKNGSCSCRDYW 814 >ref|XP_006304494.1| hypothetical protein CARUB_v10011264mg [Capsella rubella] gi|482573205|gb|EOA37392.1| hypothetical protein CARUB_v10011264mg [Capsella rubella] Length = 811 Score = 107 bits (267), Expect = 2e-21 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = +1 Query: 1 TIHLRKNLRVCGDCHNATKYISLVTGREIVVRDMQRFHHFKNGSCSCGDYW 153 TIH+RKNLRVC DCHNATKYISLVT REI+VRDMQRFHHFKNG CSCGDYW Sbjct: 761 TIHVRKNLRVCADCHNATKYISLVTRREIIVRDMQRFHHFKNGVCSCGDYW 811 >ref|XP_003526349.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Glycine max] Length = 816 Score = 106 bits (264), Expect = 4e-21 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = +1 Query: 4 IHLRKNLRVCGDCHNATKYISLVTGREIVVRDMQRFHHFKNGSCSCGDYW 153 IH+RKNLRVCGDCH ATKYISLVTGREI+VRD++RFHHFKNG CSCGDYW Sbjct: 767 IHIRKNLRVCGDCHEATKYISLVTGREIIVRDLRRFHHFKNGICSCGDYW 816 >ref|XP_006432351.1| hypothetical protein CICLE_v10000307mg [Citrus clementina] gi|568883789|ref|XP_006494628.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like isoform X1 [Citrus sinensis] gi|568883791|ref|XP_006494629.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like isoform X2 [Citrus sinensis] gi|568883793|ref|XP_006494630.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like isoform X3 [Citrus sinensis] gi|568883795|ref|XP_006494631.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like isoform X4 [Citrus sinensis] gi|557534473|gb|ESR45591.1| hypothetical protein CICLE_v10000307mg [Citrus clementina] Length = 812 Score = 103 bits (258), Expect = 2e-20 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = +1 Query: 1 TIHLRKNLRVCGDCHNATKYISLVTGREIVVRDMQRFHHFKNGSCSCGDYW 153 TIH+RKNLRVCGDCHNATKYISLVTG EI+VRDM RFH FKNG CSCGDYW Sbjct: 762 TIHIRKNLRVCGDCHNATKYISLVTGCEIIVRDMHRFHCFKNGVCSCGDYW 812 >ref|XP_006347159.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Solanum tuberosum] Length = 809 Score = 103 bits (257), Expect = 3e-20 Identities = 44/51 (86%), Positives = 46/51 (90%) Frame = +1 Query: 1 TIHLRKNLRVCGDCHNATKYISLVTGREIVVRDMQRFHHFKNGSCSCGDYW 153 TIH+RKNLRVCGDCH ATKYISLV REI+VRDM RFHHFKNG CSCGDYW Sbjct: 759 TIHIRKNLRVCGDCHTATKYISLVMKREIIVRDMHRFHHFKNGVCSCGDYW 809