BLASTX nr result
ID: Akebia23_contig00021233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00021233 (501 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006494701.1| PREDICTED: B3 domain-containing transcriptio... 56 6e-06 >ref|XP_006494701.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Citrus sinensis] Length = 290 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = -2 Query: 146 LARKRNSFFKIIHSSIIQDQQFMIPRKFVSKLGKELSDVAVLKVPNG 6 +A+ + FFK IH+S I+D++ MIP++FV K G ELS VA L VPNG Sbjct: 5 MAKSPSHFFKAIHASTIEDKKLMIPQEFVRKFGYELSAVATLAVPNG 51