BLASTX nr result
ID: Akebia23_contig00021169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00021169 (545 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004146871.1| PREDICTED: cytochrome c oxidase assembly pro... 127 2e-27 gb|EXB62662.1| Cytochrome c oxidase assembly protein COX11 [Moru... 126 4e-27 ref|XP_007015809.1| Cytochrome c oxidase assembly protein CtaG /... 126 4e-27 ref|XP_007015808.1| Cytochrome c oxidase assembly protein CtaG /... 126 4e-27 ref|XP_007015807.1| Cytochrome c oxidase assembly protein CtaG /... 126 4e-27 gb|EYU30877.1| hypothetical protein MIMGU_mgv1a010830mg [Mimulus... 125 5e-27 gb|EYU30876.1| hypothetical protein MIMGU_mgv1a010830mg [Mimulus... 125 5e-27 ref|XP_004306674.1| PREDICTED: cytochrome c oxidase assembly pro... 125 7e-27 ref|XP_007202655.1| hypothetical protein PRUPE_ppa012273mg [Prun... 125 7e-27 ref|XP_006471485.1| PREDICTED: cytochrome c oxidase assembly pro... 125 9e-27 ref|XP_006432692.1| hypothetical protein CICLE_v100021202mg, par... 125 9e-27 ref|XP_006348705.1| PREDICTED: cytochrome c oxidase assembly pro... 124 1e-26 ref|XP_006418343.1| hypothetical protein EUTSA_v10008363mg [Eutr... 124 1e-26 ref|XP_006305482.1| hypothetical protein CARUB_v10009922mg [Caps... 124 1e-26 ref|XP_004239062.1| PREDICTED: cytochrome c oxidase assembly pro... 124 1e-26 gb|AAG00893.1|AC064879_11 Similar to cytochrome-c oxidase assemb... 124 1e-26 ref|NP_171743.1| cytochrome c oxidase assembly protein CtaG / Co... 124 1e-26 ref|XP_003553055.1| PREDICTED: cytochrome c oxidase assembly pro... 124 1e-26 ref|XP_002889401.1| cytochrome c oxidase assembly protein CtaG [... 124 1e-26 ref|XP_007163355.1| hypothetical protein PHAVU_001G227800g [Phas... 124 2e-26 >ref|XP_004146871.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Cucumis sativus] gi|449521983|ref|XP_004168008.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Cucumis sativus] Length = 333 Score = 127 bits (318), Expect = 2e-27 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -1 Query: 545 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVGEE 366 AA+YFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKV EE Sbjct: 274 AAIYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE 333 >gb|EXB62662.1| Cytochrome c oxidase assembly protein COX11 [Morus notabilis] Length = 282 Score = 126 bits (316), Expect = 4e-27 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -1 Query: 545 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVGEE 366 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINNLILSYTFFKV EE Sbjct: 223 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 282 >ref|XP_007015809.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 3 [Theobroma cacao] gi|508786172|gb|EOY33428.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 3 [Theobroma cacao] Length = 279 Score = 126 bits (316), Expect = 4e-27 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -1 Query: 545 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVGEE 366 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINNLILSYTFFKV EE Sbjct: 220 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 279 >ref|XP_007015808.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 2 [Theobroma cacao] gi|508786171|gb|EOY33427.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 2 [Theobroma cacao] Length = 269 Score = 126 bits (316), Expect = 4e-27 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -1 Query: 545 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVGEE 366 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINNLILSYTFFKV EE Sbjct: 210 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 269 >ref|XP_007015807.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 1 [Theobroma cacao] gi|508786170|gb|EOY33426.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 1 [Theobroma cacao] Length = 278 Score = 126 bits (316), Expect = 4e-27 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -1 Query: 545 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVGEE 366 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINNLILSYTFFKV EE Sbjct: 219 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 278 >gb|EYU30877.1| hypothetical protein MIMGU_mgv1a010830mg [Mimulus guttatus] Length = 292 Score = 125 bits (315), Expect = 5e-27 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -1 Query: 545 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVGEE 366 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKM+GINNLILSYTFFKV EE Sbjct: 232 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMEGINNLILSYTFFKVSEE 291 >gb|EYU30876.1| hypothetical protein MIMGU_mgv1a010830mg [Mimulus guttatus] Length = 300 Score = 125 bits (315), Expect = 5e-27 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -1 Query: 545 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVGEE 366 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKM+GINNLILSYTFFKV EE Sbjct: 240 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMEGINNLILSYTFFKVSEE 299 >ref|XP_004306674.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 266 Score = 125 bits (314), Expect = 7e-27 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = -1 Query: 545 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVGEE 366 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV EE Sbjct: 207 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNIILSYTFFKVSEE 266 >ref|XP_007202655.1| hypothetical protein PRUPE_ppa012273mg [Prunus persica] gi|462398186|gb|EMJ03854.1| hypothetical protein PRUPE_ppa012273mg [Prunus persica] Length = 177 Score = 125 bits (314), Expect = 7e-27 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = -1 Query: 545 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVGEE 366 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV EE Sbjct: 118 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNIILSYTFFKVSEE 177 >ref|XP_006471485.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like isoform X1 [Citrus sinensis] gi|568834792|ref|XP_006471486.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like isoform X2 [Citrus sinensis] Length = 277 Score = 125 bits (313), Expect = 9e-27 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = -1 Query: 545 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVGEE 366 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINNLILSYTFFKV E+ Sbjct: 218 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVNED 277 >ref|XP_006432692.1| hypothetical protein CICLE_v100021202mg, partial [Citrus clementina] gi|557534814|gb|ESR45932.1| hypothetical protein CICLE_v100021202mg, partial [Citrus clementina] Length = 119 Score = 125 bits (313), Expect = 9e-27 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = -1 Query: 545 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVGEE 366 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINNLILSYTFFKV E+ Sbjct: 60 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVNED 119 >ref|XP_006348705.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Solanum tuberosum] Length = 287 Score = 124 bits (312), Expect = 1e-26 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = -1 Query: 545 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVGEE 366 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKV ++ Sbjct: 228 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSDK 287 >ref|XP_006418343.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum] gi|567156392|ref|XP_006418345.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum] gi|557096114|gb|ESQ36696.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum] gi|557096116|gb|ESQ36698.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum] Length = 291 Score = 124 bits (312), Expect = 1e-26 Identities = 57/60 (95%), Positives = 58/60 (96%) Frame = -1 Query: 545 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVGEE 366 A VYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINNLILSYTFFKV EE Sbjct: 214 AGVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 273 >ref|XP_006305482.1| hypothetical protein CARUB_v10009922mg [Capsella rubella] gi|482574193|gb|EOA38380.1| hypothetical protein CARUB_v10009922mg [Capsella rubella] Length = 287 Score = 124 bits (312), Expect = 1e-26 Identities = 57/60 (95%), Positives = 58/60 (96%) Frame = -1 Query: 545 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVGEE 366 A VYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINNLILSYTFFKV EE Sbjct: 210 AGVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 269 >ref|XP_004239062.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Solanum lycopersicum] Length = 287 Score = 124 bits (312), Expect = 1e-26 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = -1 Query: 545 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVGEE 366 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKV ++ Sbjct: 228 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSDK 287 >gb|AAG00893.1|AC064879_11 Similar to cytochrome-c oxidase assembly protein [Arabidopsis thaliana] Length = 216 Score = 124 bits (312), Expect = 1e-26 Identities = 57/60 (95%), Positives = 58/60 (96%) Frame = -1 Query: 545 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVGEE 366 A VYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINNLILSYTFFKV EE Sbjct: 139 AGVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 198 >ref|NP_171743.1| cytochrome c oxidase assembly protein CtaG / Cox11 [Arabidopsis thaliana] gi|75151034|sp|Q8GWR0.1|COX11_ARATH RecName: Full=Cytochrome c oxidase assembly protein COX11, mitochondrial; Flags: Precursor gi|26452392|dbj|BAC43281.1| unknown protein [Arabidopsis thaliana] gi|28950841|gb|AAO63344.1| At1g02410 [Arabidopsis thaliana] gi|332189306|gb|AEE27427.1| cytochrome c oxidase assembly protein CtaG / Cox11 [Arabidopsis thaliana] Length = 287 Score = 124 bits (312), Expect = 1e-26 Identities = 57/60 (95%), Positives = 58/60 (96%) Frame = -1 Query: 545 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVGEE 366 A VYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINNLILSYTFFKV EE Sbjct: 210 AGVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 269 >ref|XP_003553055.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Glycine max] Length = 284 Score = 124 bits (312), Expect = 1e-26 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = -1 Query: 545 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVGEE 366 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKM+GINN+ILSYTFFKV EE Sbjct: 225 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMNGINNIILSYTFFKVSEE 284 >ref|XP_002889401.1| cytochrome c oxidase assembly protein CtaG [Arabidopsis lyrata subsp. lyrata] gi|297335243|gb|EFH65660.1| cytochrome c oxidase assembly protein CtaG [Arabidopsis lyrata subsp. lyrata] Length = 287 Score = 124 bits (312), Expect = 1e-26 Identities = 57/60 (95%), Positives = 58/60 (96%) Frame = -1 Query: 545 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVGEE 366 A VYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINNLILSYTFFKV EE Sbjct: 210 AGVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 269 >ref|XP_007163355.1| hypothetical protein PHAVU_001G227800g [Phaseolus vulgaris] gi|593800638|ref|XP_007163356.1| hypothetical protein PHAVU_001G227800g [Phaseolus vulgaris] gi|561036819|gb|ESW35349.1| hypothetical protein PHAVU_001G227800g [Phaseolus vulgaris] gi|561036820|gb|ESW35350.1| hypothetical protein PHAVU_001G227800g [Phaseolus vulgaris] Length = 268 Score = 124 bits (311), Expect = 2e-26 Identities = 56/60 (93%), Positives = 59/60 (98%) Frame = -1 Query: 545 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVGEE 366 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKM+GINN++LSYTFFKV EE Sbjct: 209 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMNGINNIVLSYTFFKVSEE 268