BLASTX nr result
ID: Akebia23_contig00020914
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00020914 (428 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521910.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002521910.1| conserved hypothetical protein [Ricinus communis] gi|223538948|gb|EEF40546.1| conserved hypothetical protein [Ricinus communis] Length = 168 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/56 (58%), Positives = 39/56 (69%), Gaps = 2/56 (3%) Frame = -1 Query: 428 PDSSVLNDEGMMNEELAESLWKMAELSSM-NEEGLVVVTTEPPA-QAVRKRQHTLT 267 P SSV+ND + E+ ESL K AEL + NEEG+V+V T PP QAVRKR HTLT Sbjct: 76 PTSSVINDGRVREEKYTESLRKRAELPKIVNEEGIVIVATGPPPFQAVRKRHHTLT 131