BLASTX nr result
ID: Akebia23_contig00020510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00020510 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515273.1| ATP-dependent Clp protease proteolytic subun... 62 1e-07 >ref|XP_002515273.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus communis] gi|223545753|gb|EEF47257.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus communis] Length = 305 Score = 61.6 bits (148), Expect = 1e-07 Identities = 34/62 (54%), Positives = 44/62 (70%), Gaps = 2/62 (3%) Frame = -1 Query: 187 MAHSCVSTSASALRFSSHVFSSNPSPLSETQKLYLPIKPLHSRDSRR--SVSRNGKISSA 14 MAHS +S+SAS+LRF S VFS NPS ++ KL LP +PL SR R+ S+ +N + SSA Sbjct: 1 MAHSLLSSSASSLRFGSLVFSPNPSSAPDSHKLSLPFEPLRSRKFRKLSSIRKNSQPSSA 60 Query: 13 KA 8 KA Sbjct: 61 KA 62