BLASTX nr result
ID: Akebia23_contig00019607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00019607 (641 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004232884.1| PREDICTED: serine/threonine-protein kinase H... 57 4e-06 >ref|XP_004232884.1| PREDICTED: serine/threonine-protein kinase HT1-like [Solanum lycopersicum] Length = 504 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -3 Query: 189 MEGEANSWVRRAKFSHTVCHRLDSSRFPLIPLS 91 M+ EANSW+RR KFSHTVCHRLDS+R IP+S Sbjct: 1 MDDEANSWIRRTKFSHTVCHRLDSARLTSIPIS 33