BLASTX nr result
ID: Akebia23_contig00019295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00019295 (378 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540456.1| PREDICTED: plant intracellular Ras-group-rel... 82 6e-14 ref|XP_006464726.1| PREDICTED: plant intracellular Ras-group-rel... 82 1e-13 ref|XP_006451917.1| hypothetical protein CICLE_v10007835mg [Citr... 82 1e-13 ref|XP_002284846.1| PREDICTED: leucine-rich repeat-containing pr... 82 1e-13 ref|XP_003634682.1| PREDICTED: leucine-rich repeat-containing pr... 82 1e-13 ref|XP_004487690.1| PREDICTED: leucine-rich repeat-containing pr... 81 1e-13 ref|XP_003543250.1| PREDICTED: plant intracellular Ras-group-rel... 81 1e-13 ref|XP_007214664.1| hypothetical protein PRUPE_ppa003338mg [Prun... 80 3e-13 ref|XP_007149595.1| hypothetical protein PHAVU_005G083000g [Phas... 79 5e-13 ref|XP_006377774.1| hypothetical protein POPTR_0011s12230g [Popu... 79 5e-13 ref|XP_002316909.1| leucine-rich repeat family protein [Populus ... 79 5e-13 ref|XP_007021369.1| Leucine-rich repeat (LRR) family protein iso... 79 7e-13 emb|CAA73132.1| hypothetical protein [Silene latifolia] 77 3e-12 ref|XP_006827793.1| hypothetical protein AMTR_s00009p00266540 [A... 77 3e-12 dbj|BAJ85262.1| predicted protein [Hordeum vulgare subsp. vulgare] 76 6e-12 gb|AFW74119.2| hypothetical protein ZEAMMB73_915670 [Zea mays] 75 7e-12 ref|NP_001169465.1| uncharacterized protein LOC100383336 [Zea ma... 75 7e-12 gb|ACG39716.1| leucine-rich repeat-containing protein 40 [Zea mays] 75 7e-12 dbj|BAB02370.1| leucine-rich repeat protein; contains similarity... 75 1e-11 ref|XP_007021362.1| Leucine-rich repeat (LRR) family protein [Th... 75 1e-11 >ref|XP_003540456.1| PREDICTED: plant intracellular Ras-group-related LRR protein 6-like [Glycine max] Length = 586 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -1 Query: 378 ELGLLESSLQALRLDGNPLRSIRRTILDRGTKAVLNYLKEKIPEQ 244 ELGLLE SLQALRLDGNPLRSIRRT+LDRGTKAVL YLK+K+PEQ Sbjct: 540 ELGLLEPSLQALRLDGNPLRSIRRTVLDRGTKAVLQYLKDKLPEQ 584 >ref|XP_006464726.1| PREDICTED: plant intracellular Ras-group-related LRR protein 6-like [Citrus sinensis] Length = 583 Score = 81.6 bits (200), Expect = 1e-13 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -1 Query: 378 ELGLLESSLQALRLDGNPLRSIRRTILDRGTKAVLNYLKEKIPE 247 ELGLLE SLQALRLDGNPLRSIRRTILDRGTKAVL YLK+KIPE Sbjct: 539 ELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPE 582 >ref|XP_006451917.1| hypothetical protein CICLE_v10007835mg [Citrus clementina] gi|557555143|gb|ESR65157.1| hypothetical protein CICLE_v10007835mg [Citrus clementina] Length = 583 Score = 81.6 bits (200), Expect = 1e-13 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -1 Query: 378 ELGLLESSLQALRLDGNPLRSIRRTILDRGTKAVLNYLKEKIPE 247 ELGLLE SLQALRLDGNPLRSIRRTILDRGTKAVL YLK+KIPE Sbjct: 539 ELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPE 582 >ref|XP_002284846.1| PREDICTED: leucine-rich repeat-containing protein 40-like isoform 1 [Vitis vinifera] Length = 588 Score = 81.6 bits (200), Expect = 1e-13 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -1 Query: 378 ELGLLESSLQALRLDGNPLRSIRRTILDRGTKAVLNYLKEKIPE 247 ELGLLE SLQALRLDGNPLRSIRRTILDRGTKAVL YLK+KIPE Sbjct: 544 ELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPE 587 >ref|XP_003634682.1| PREDICTED: leucine-rich repeat-containing protein 40-like isoform 2 [Vitis vinifera] gi|302143032|emb|CBI20327.3| unnamed protein product [Vitis vinifera] Length = 584 Score = 81.6 bits (200), Expect = 1e-13 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -1 Query: 378 ELGLLESSLQALRLDGNPLRSIRRTILDRGTKAVLNYLKEKIPE 247 ELGLLE SLQALRLDGNPLRSIRRTILDRGTKAVL YLK+KIPE Sbjct: 540 ELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPE 583 >ref|XP_004487690.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Cicer arietinum] Length = 585 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -1 Query: 378 ELGLLESSLQALRLDGNPLRSIRRTILDRGTKAVLNYLKEKIPEQ 244 ELGLLE SLQALRLDGNPLRSIRRT+LD+GTKAVL YLK+K+PEQ Sbjct: 541 ELGLLEPSLQALRLDGNPLRSIRRTVLDKGTKAVLKYLKDKLPEQ 585 >ref|XP_003543250.1| PREDICTED: plant intracellular Ras-group-related LRR protein 6-like [Glycine max] Length = 583 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -1 Query: 378 ELGLLESSLQALRLDGNPLRSIRRTILDRGTKAVLNYLKEKIPEQ 244 ELGLLE SLQALRLDGNPLRSIRRT+LD+GTKAVL YLK+K+PEQ Sbjct: 539 ELGLLEPSLQALRLDGNPLRSIRRTVLDKGTKAVLQYLKDKLPEQ 583 >ref|XP_007214664.1| hypothetical protein PRUPE_ppa003338mg [Prunus persica] gi|462410529|gb|EMJ15863.1| hypothetical protein PRUPE_ppa003338mg [Prunus persica] Length = 584 Score = 80.1 bits (196), Expect = 3e-13 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -1 Query: 378 ELGLLESSLQALRLDGNPLRSIRRTILDRGTKAVLNYLKEKIPE 247 ELGLLE SLQALRLDGNPLRSIRRT+LDRGTKAVLNYLK+KI E Sbjct: 540 ELGLLEPSLQALRLDGNPLRSIRRTVLDRGTKAVLNYLKDKIVE 583 >ref|XP_007149595.1| hypothetical protein PHAVU_005G083000g [Phaseolus vulgaris] gi|561022859|gb|ESW21589.1| hypothetical protein PHAVU_005G083000g [Phaseolus vulgaris] Length = 586 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -1 Query: 378 ELGLLESSLQALRLDGNPLRSIRRTILDRGTKAVLNYLKEKIPE 247 ELGLLE SLQALRLDGNPLRSIRRT+L +GTKAVLNYLK+K+PE Sbjct: 543 ELGLLEPSLQALRLDGNPLRSIRRTVLSKGTKAVLNYLKDKLPE 586 >ref|XP_006377774.1| hypothetical protein POPTR_0011s12230g [Populus trichocarpa] gi|550328216|gb|ERP55571.1| hypothetical protein POPTR_0011s12230g [Populus trichocarpa] Length = 584 Score = 79.3 bits (194), Expect = 5e-13 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -1 Query: 378 ELGLLESSLQALRLDGNPLRSIRRTILDRGTKAVLNYLKEKIPE 247 ELGLLE SLQALRLDGNPLRSIRRTILDRGTKAVL YL +KIPE Sbjct: 540 ELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLMDKIPE 583 >ref|XP_002316909.1| leucine-rich repeat family protein [Populus trichocarpa] gi|222859974|gb|EEE97521.1| leucine-rich repeat family protein [Populus trichocarpa] Length = 580 Score = 79.3 bits (194), Expect = 5e-13 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -1 Query: 378 ELGLLESSLQALRLDGNPLRSIRRTILDRGTKAVLNYLKEKIPE 247 ELGLLE SLQALRLDGNPLRSIRRTILDRGTKAVL YL +KIPE Sbjct: 536 ELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLMDKIPE 579 >ref|XP_007021369.1| Leucine-rich repeat (LRR) family protein isoform 1 [Theobroma cacao] gi|508720997|gb|EOY12894.1| Leucine-rich repeat (LRR) family protein isoform 1 [Theobroma cacao] Length = 584 Score = 79.0 bits (193), Expect = 7e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 378 ELGLLESSLQALRLDGNPLRSIRRTILDRGTKAVLNYLKEKIPEQ 244 ELGLLE SLQ LRLDGNPLRSIRR ILD+GTKAVL YLK+KIPEQ Sbjct: 540 ELGLLEPSLQVLRLDGNPLRSIRRAILDKGTKAVLKYLKDKIPEQ 584 >emb|CAA73132.1| hypothetical protein [Silene latifolia] Length = 581 Score = 77.0 bits (188), Expect = 3e-12 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -1 Query: 378 ELGLLESSLQALRLDGNPLRSIRRTILDRGTKAVLNYLKEKI 253 ELGLLE SLQALRLDGNPLRSIRRTILDRGTKAVL YLK+KI Sbjct: 540 ELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLQYLKDKI 581 >ref|XP_006827793.1| hypothetical protein AMTR_s00009p00266540 [Amborella trichopoda] gi|548832413|gb|ERM95209.1| hypothetical protein AMTR_s00009p00266540 [Amborella trichopoda] Length = 585 Score = 76.6 bits (187), Expect = 3e-12 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -1 Query: 378 ELGLLESSLQALRLDGNPLRSIRRTILDRGTKAVLNYLKEKIP 250 ELGLLES+LQ LRLDGNPLRSIRR ILDRGTKAVL YLK+KIP Sbjct: 542 ELGLLESTLQVLRLDGNPLRSIRRPILDRGTKAVLKYLKDKIP 584 >dbj|BAJ85262.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 223 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 378 ELGLLESSLQALRLDGNPLRSIRRTILDRGTKAVLNYLKEKIP 250 ELGLLE SLQ L+LDGNPLRSIRRT+L+RGTKAVL+YLKEK+P Sbjct: 179 ELGLLEPSLQVLKLDGNPLRSIRRTVLERGTKAVLSYLKEKLP 221 >gb|AFW74119.2| hypothetical protein ZEAMMB73_915670 [Zea mays] Length = 408 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -1 Query: 378 ELGLLESSLQALRLDGNPLRSIRRTILDRGTKAVLNYLKEKIPEQ 244 ELGLLE++LQ L+LDGNPLRSIRRT+L+RGTKAVL YLKEK+P + Sbjct: 364 ELGLLEANLQVLKLDGNPLRSIRRTLLERGTKAVLKYLKEKLPSE 408 >ref|NP_001169465.1| uncharacterized protein LOC100383336 [Zea mays] gi|224029533|gb|ACN33842.1| unknown [Zea mays] Length = 584 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -1 Query: 378 ELGLLESSLQALRLDGNPLRSIRRTILDRGTKAVLNYLKEKIPEQ 244 ELGLLE++LQ L+LDGNPLRSIRRT+L+RGTKAVL YLKEK+P + Sbjct: 540 ELGLLEANLQVLKLDGNPLRSIRRTLLERGTKAVLKYLKEKLPSE 584 >gb|ACG39716.1| leucine-rich repeat-containing protein 40 [Zea mays] Length = 586 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -1 Query: 378 ELGLLESSLQALRLDGNPLRSIRRTILDRGTKAVLNYLKEKIPEQ 244 ELGLLE++LQ L+LDGNPLRSIRRT+L+RGTKAVL YLKEK+P + Sbjct: 542 ELGLLEANLQVLKLDGNPLRSIRRTLLERGTKAVLKYLKEKLPSE 586 >dbj|BAB02370.1| leucine-rich repeat protein; contains similarity to elicitor-inducible receptor EIR [Arabidopsis thaliana] Length = 594 Score = 75.1 bits (183), Expect = 1e-11 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -1 Query: 378 ELGLLESSLQALRLDGNPLRSIRRTILDRGTKAVLNYLKEKIPEQ 244 ELGLLE +L+ LRLDGNPLRSIRR IL+RGTKAVLNYLK+++P+Q Sbjct: 550 ELGLLEPTLEVLRLDGNPLRSIRRPILERGTKAVLNYLKDRLPDQ 594 >ref|XP_007021362.1| Leucine-rich repeat (LRR) family protein [Theobroma cacao] gi|508720990|gb|EOY12887.1| Leucine-rich repeat (LRR) family protein [Theobroma cacao] Length = 190 Score = 75.1 bits (183), Expect = 1e-11 Identities = 38/45 (84%), Positives = 40/45 (88%) Frame = -1 Query: 378 ELGLLESSLQALRLDGNPLRSIRRTILDRGTKAVLNYLKEKIPEQ 244 ELGLLE SLQ LRLDGNPLRSIRR ILD+GTKAVL YLK+KI EQ Sbjct: 146 ELGLLEPSLQVLRLDGNPLRSIRRAILDKGTKAVLKYLKDKILEQ 190