BLASTX nr result
ID: Akebia23_contig00017962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00017962 (2943 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532208.1| conserved hypothetical protein [Ricinus comm... 69 1e-08 ref|XP_002302833.2| hypothetical protein POPTR_0002s22340g [Popu... 63 9e-07 >ref|XP_002532208.1| conserved hypothetical protein [Ricinus communis] gi|223528104|gb|EEF30177.1| conserved hypothetical protein [Ricinus communis] Length = 368 Score = 68.9 bits (167), Expect = 1e-08 Identities = 32/65 (49%), Positives = 46/65 (70%) Frame = -2 Query: 2942 GNFMPNFESQPCDRIPEPGEKIRIVSFGTEEHKKAKQLRALFMEFSEHLQRLHKSLTLEE 2763 GN MP ++ + R + G+ +++V G+EE+K KQLR LF+EF+EH +RLHK L LEE Sbjct: 302 GNLMPKYQEKLDFRNNDTGKDLKVVCSGSEEYKTGKQLRDLFLEFAEHQRRLHKRLALEE 361 Query: 2762 KKIMQ 2748 +KI Q Sbjct: 362 RKIFQ 366 >ref|XP_002302833.2| hypothetical protein POPTR_0002s22340g [Populus trichocarpa] gi|550345584|gb|EEE82106.2| hypothetical protein POPTR_0002s22340g [Populus trichocarpa] Length = 398 Score = 62.8 bits (151), Expect = 9e-07 Identities = 28/49 (57%), Positives = 39/49 (79%) Frame = -2 Query: 2888 GEKIRIVSFGTEEHKKAKQLRALFMEFSEHLQRLHKSLTLEEKKIMQPA 2742 G +++V G+EE+ AKQLR LFMEF+EH +RLHK L +EE+KI+QP+ Sbjct: 347 GHALKVVCPGSEEYTTAKQLRDLFMEFTEHQRRLHKRLAMEERKILQPS 395