BLASTX nr result
ID: Akebia23_contig00017831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00017831 (625 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006387741.1| hypothetical protein POPTR_0626s00200g [Popu... 60 4e-07 gb|ABK93221.1| unknown [Populus trichocarpa] 60 7e-07 ref|XP_007045790.1| Uncharacterized protein TCM_011471 [Theobrom... 57 5e-06 >ref|XP_006387741.1| hypothetical protein POPTR_0626s00200g [Populus trichocarpa] gi|550308313|gb|ERP46655.1| hypothetical protein POPTR_0626s00200g [Populus trichocarpa] Length = 84 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/46 (63%), Positives = 30/46 (65%) Frame = -2 Query: 369 WGIFSLLSDSEHESNKKIMKAPGRDHNMYREDFERSPKDYFRDLRK 232 WGI S L S K MKAPGRDH M R DFER PK YF+DLRK Sbjct: 39 WGIGSALFSSPEPDAGKTMKAPGRDHRMPRADFERDPKGYFKDLRK 84 >gb|ABK93221.1| unknown [Populus trichocarpa] Length = 84 Score = 59.7 bits (143), Expect = 7e-07 Identities = 29/46 (63%), Positives = 30/46 (65%) Frame = -2 Query: 369 WGIFSLLSDSEHESNKKIMKAPGRDHNMYREDFERSPKDYFRDLRK 232 WGI S L S K MKAPGRDH M R DFER PK YF+DLRK Sbjct: 39 WGIGSALFSSPGPDAGKTMKAPGRDHRMPRADFERDPKGYFKDLRK 84 >ref|XP_007045790.1| Uncharacterized protein TCM_011471 [Theobroma cacao] gi|508709725|gb|EOY01622.1| Uncharacterized protein TCM_011471 [Theobroma cacao] Length = 98 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -2 Query: 330 SNKKIMKAPGRDHNMYREDFERSPKDYFRDLRK 232 S+KK MKAPGR+H +YR+DF R+PK YFRDLRK Sbjct: 63 SSKKTMKAPGRNHRIYRDDFTRNPKGYFRDLRK 95