BLASTX nr result
ID: Akebia23_contig00017789
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00017789 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBL94180.1| Conserved hypothetical protein [Malus domestica] 57 2e-06 gb|ADP30961.1| dehydration-induced 19-like protein [Gossypium hi... 57 2e-06 ref|XP_006488893.1| PREDICTED: protein DEHYDRATION-INDUCED 19 ho... 56 6e-06 ref|XP_006419455.1| hypothetical protein CICLE_v10005825mg [Citr... 56 6e-06 ref|XP_006419454.1| hypothetical protein CICLE_v10005825mg [Citr... 56 6e-06 ref|XP_006472164.1| PREDICTED: protein DEHYDRATION-INDUCED 19 ho... 55 8e-06 >emb|CBL94180.1| Conserved hypothetical protein [Malus domestica] Length = 200 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 366 RSVQTPPLSDKDQEEKASRSEFVQGLLLSTMFDDI 262 RSVQ PPLS KDQEE+A R EFVQGLL+ST+FDD+ Sbjct: 166 RSVQQPPLSRKDQEEQARRCEFVQGLLMSTIFDDL 200 >gb|ADP30961.1| dehydration-induced 19-like protein [Gossypium hirsutum] Length = 218 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -1 Query: 366 RSVQTPPLSDKDQEEKASRSEFVQGLLLSTMFDDIL 259 R+VQ+PPLS KDQEEKA R EFV+GLLLST+ DD+L Sbjct: 183 RNVQSPPLSVKDQEEKAKRCEFVKGLLLSTILDDVL 218 >ref|XP_006488893.1| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 4-like [Citrus sinensis] Length = 223 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 366 RSVQTPPLSDKDQEEKASRSEFVQGLLLSTMFDDIL 259 R VQ PPLSDKDQEEKA +SEFVQGL+LST+ D L Sbjct: 188 RHVQQPPLSDKDQEEKARKSEFVQGLVLSTILGDYL 223 >ref|XP_006419455.1| hypothetical protein CICLE_v10005825mg [Citrus clementina] gi|557521328|gb|ESR32695.1| hypothetical protein CICLE_v10005825mg [Citrus clementina] Length = 223 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 366 RSVQTPPLSDKDQEEKASRSEFVQGLLLSTMFDDIL 259 R VQ PPLSDKDQEEKA +SEFVQGL+LST+ D L Sbjct: 188 RHVQQPPLSDKDQEEKARKSEFVQGLVLSTILGDYL 223 >ref|XP_006419454.1| hypothetical protein CICLE_v10005825mg [Citrus clementina] gi|557521327|gb|ESR32694.1| hypothetical protein CICLE_v10005825mg [Citrus clementina] Length = 180 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 366 RSVQTPPLSDKDQEEKASRSEFVQGLLLSTMFDDIL 259 R VQ PPLSDKDQEEKA +SEFVQGL+LST+ D L Sbjct: 145 RHVQQPPLSDKDQEEKARKSEFVQGLVLSTILGDYL 180 >ref|XP_006472164.1| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 3-like [Citrus sinensis] Length = 220 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -1 Query: 366 RSVQTPPLSDKDQEEKASRSEFVQGLLLSTMFDDIL 259 R+VQ+ P+S KDQEEKA RS+FVQGLLLST+ DDIL Sbjct: 185 RNVQSAPVSLKDQEEKAKRSDFVQGLLLSTILDDIL 220