BLASTX nr result
ID: Akebia23_contig00017784
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00017784 (805 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC20600.1| Eukaryotic translation initiation factor 2 subuni... 64 6e-08 ref|XP_006349820.1| PREDICTED: eukaryotic translation initiation... 64 6e-08 ref|XP_007150547.1| hypothetical protein PHAVU_005G161600g [Phas... 64 6e-08 ref|XP_007150546.1| hypothetical protein PHAVU_005G161500g [Phas... 64 6e-08 ref|XP_007149283.1| hypothetical protein PHAVU_005G057300g [Phas... 64 6e-08 ref|XP_006419547.1| hypothetical protein CICLE_v10004918mg [Citr... 64 6e-08 ref|XP_007035623.1| Eukaryotic translation initiation factor 2 g... 64 6e-08 ref|XP_007035622.1| Eukaryotic translation initiation factor 2 g... 64 6e-08 ref|XP_007035621.1| Eukaryotic translation initiation factor 2 g... 64 6e-08 ref|XP_004488828.1| PREDICTED: eukaryotic translation initiation... 64 6e-08 ref|XP_004488827.1| PREDICTED: eukaryotic translation initiation... 64 6e-08 ref|XP_004296852.1| PREDICTED: eukaryotic translation initiation... 64 6e-08 ref|XP_007223037.1| hypothetical protein PRUPE_ppa005372mg [Prun... 64 6e-08 ref|XP_004252908.1| PREDICTED: eukaryotic translation initiation... 64 6e-08 ref|XP_004229250.1| PREDICTED: eukaryotic translation initiation... 64 6e-08 ref|XP_003531501.1| PREDICTED: eukaryotic translation initiation... 64 6e-08 ref|NP_001241486.1| uncharacterized protein LOC100784099 [Glycin... 64 6e-08 gb|ACU18507.1| unknown [Glycine max] 64 6e-08 ref|XP_007209433.1| hypothetical protein PRUPE_ppa009587mg [Prun... 64 8e-08 ref|XP_006663865.1| PREDICTED: eukaryotic translation initiation... 63 1e-07 >gb|EXC20600.1| Eukaryotic translation initiation factor 2 subunit 3 [Morus notabilis] Length = 464 Score = 63.9 bits (154), Expect = 6e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 122 LIEVGTTMNPTLTHADRLVGQVLGEVGSLLEVFVELKV 235 LI VGTTM+PTLT ADRLVGQVLGEVGSL EVFVEL+V Sbjct: 328 LIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVFVELEV 365 >ref|XP_006349820.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 3-like [Solanum tuberosum] Length = 464 Score = 63.9 bits (154), Expect = 6e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 122 LIEVGTTMNPTLTHADRLVGQVLGEVGSLLEVFVELKV 235 LI VGTTM+PTLT ADRLVGQVLGEVGSL EVFVEL+V Sbjct: 328 LIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVFVELEV 365 >ref|XP_007150547.1| hypothetical protein PHAVU_005G161600g [Phaseolus vulgaris] gi|561023811|gb|ESW22541.1| hypothetical protein PHAVU_005G161600g [Phaseolus vulgaris] Length = 466 Score = 63.9 bits (154), Expect = 6e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 122 LIEVGTTMNPTLTHADRLVGQVLGEVGSLLEVFVELKV 235 LI VGTTM+PTLT ADRLVGQVLGEVGSL EVFVEL+V Sbjct: 328 LIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVFVELEV 365 >ref|XP_007150546.1| hypothetical protein PHAVU_005G161500g [Phaseolus vulgaris] gi|561023810|gb|ESW22540.1| hypothetical protein PHAVU_005G161500g [Phaseolus vulgaris] Length = 466 Score = 63.9 bits (154), Expect = 6e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 122 LIEVGTTMNPTLTHADRLVGQVLGEVGSLLEVFVELKV 235 LI VGTTM+PTLT ADRLVGQVLGEVGSL EVFVEL+V Sbjct: 328 LIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVFVELEV 365 >ref|XP_007149283.1| hypothetical protein PHAVU_005G057300g [Phaseolus vulgaris] gi|561022547|gb|ESW21277.1| hypothetical protein PHAVU_005G057300g [Phaseolus vulgaris] Length = 466 Score = 63.9 bits (154), Expect = 6e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 122 LIEVGTTMNPTLTHADRLVGQVLGEVGSLLEVFVELKV 235 LI VGTTM+PTLT ADRLVGQVLGEVGSL EVFVEL+V Sbjct: 328 LIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVFVELEV 365 >ref|XP_006419547.1| hypothetical protein CICLE_v10004918mg [Citrus clementina] gi|567852769|ref|XP_006419548.1| hypothetical protein CICLE_v10004918mg [Citrus clementina] gi|568871776|ref|XP_006489056.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 3-like isoform X1 [Citrus sinensis] gi|568871778|ref|XP_006489057.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 3-like isoform X2 [Citrus sinensis] gi|557521420|gb|ESR32787.1| hypothetical protein CICLE_v10004918mg [Citrus clementina] gi|557521421|gb|ESR32788.1| hypothetical protein CICLE_v10004918mg [Citrus clementina] Length = 466 Score = 63.9 bits (154), Expect = 6e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 122 LIEVGTTMNPTLTHADRLVGQVLGEVGSLLEVFVELKV 235 LI VGTTM+PTLT ADRLVGQVLGEVGSL EVFVEL+V Sbjct: 328 LIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVFVELEV 365 >ref|XP_007035623.1| Eukaryotic translation initiation factor 2 gamma subunit, GAMMA isoform 3 [Theobroma cacao] gi|508714652|gb|EOY06549.1| Eukaryotic translation initiation factor 2 gamma subunit, GAMMA isoform 3 [Theobroma cacao] Length = 431 Score = 63.9 bits (154), Expect = 6e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 122 LIEVGTTMNPTLTHADRLVGQVLGEVGSLLEVFVELKV 235 LI VGTTM+PTLT ADRLVGQVLGEVGSL EVFVEL+V Sbjct: 295 LIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVFVELEV 332 >ref|XP_007035622.1| Eukaryotic translation initiation factor 2 gamma subunit, GAMMA isoform 2 [Theobroma cacao] gi|508714651|gb|EOY06548.1| Eukaryotic translation initiation factor 2 gamma subunit, GAMMA isoform 2 [Theobroma cacao] Length = 489 Score = 63.9 bits (154), Expect = 6e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 122 LIEVGTTMNPTLTHADRLVGQVLGEVGSLLEVFVELKV 235 LI VGTTM+PTLT ADRLVGQVLGEVGSL EVFVEL+V Sbjct: 353 LIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVFVELEV 390 >ref|XP_007035621.1| Eukaryotic translation initiation factor 2 gamma subunit, GAMMA isoform 1 [Theobroma cacao] gi|508714650|gb|EOY06547.1| Eukaryotic translation initiation factor 2 gamma subunit, GAMMA isoform 1 [Theobroma cacao] Length = 464 Score = 63.9 bits (154), Expect = 6e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 122 LIEVGTTMNPTLTHADRLVGQVLGEVGSLLEVFVELKV 235 LI VGTTM+PTLT ADRLVGQVLGEVGSL EVFVEL+V Sbjct: 328 LIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVFVELEV 365 >ref|XP_004488828.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 3-like isoform X2 [Cicer arietinum] Length = 466 Score = 63.9 bits (154), Expect = 6e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 122 LIEVGTTMNPTLTHADRLVGQVLGEVGSLLEVFVELKV 235 LI VGTTM+PTLT ADRLVGQVLGEVGSL EVFVEL+V Sbjct: 328 LIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVFVELEV 365 >ref|XP_004488827.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 3-like isoform X1 [Cicer arietinum] Length = 475 Score = 63.9 bits (154), Expect = 6e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 122 LIEVGTTMNPTLTHADRLVGQVLGEVGSLLEVFVELKV 235 LI VGTTM+PTLT ADRLVGQVLGEVGSL EVFVEL+V Sbjct: 337 LIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVFVELEV 374 >ref|XP_004296852.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 3-like [Fragaria vesca subsp. vesca] Length = 464 Score = 63.9 bits (154), Expect = 6e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 122 LIEVGTTMNPTLTHADRLVGQVLGEVGSLLEVFVELKV 235 LI VGTTM+PTLT ADRLVGQVLGEVGSL EVFVEL+V Sbjct: 328 LIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVFVELEV 365 >ref|XP_007223037.1| hypothetical protein PRUPE_ppa005372mg [Prunus persica] gi|462419973|gb|EMJ24236.1| hypothetical protein PRUPE_ppa005372mg [Prunus persica] Length = 464 Score = 63.9 bits (154), Expect = 6e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 122 LIEVGTTMNPTLTHADRLVGQVLGEVGSLLEVFVELKV 235 LI VGTTM+PTLT ADRLVGQVLGEVGSL EVFVEL+V Sbjct: 328 LIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVFVELEV 365 >ref|XP_004252908.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 3-like [Solanum lycopersicum] Length = 464 Score = 63.9 bits (154), Expect = 6e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 122 LIEVGTTMNPTLTHADRLVGQVLGEVGSLLEVFVELKV 235 LI VGTTM+PTLT ADRLVGQVLGEVGSL EVFVEL+V Sbjct: 328 LIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVFVELEV 365 >ref|XP_004229250.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 3-like [Solanum lycopersicum] Length = 503 Score = 63.9 bits (154), Expect = 6e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 122 LIEVGTTMNPTLTHADRLVGQVLGEVGSLLEVFVELKV 235 LI VGTTM+PTLT ADRLVGQVLGEVGSL EVFVEL+V Sbjct: 367 LIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVFVELEV 404 >ref|XP_003531501.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 3 [Glycine max] Length = 466 Score = 63.9 bits (154), Expect = 6e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 122 LIEVGTTMNPTLTHADRLVGQVLGEVGSLLEVFVELKV 235 LI VGTTM+PTLT ADRLVGQVLGEVGSL EVFVEL+V Sbjct: 328 LIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVFVELEV 365 >ref|NP_001241486.1| uncharacterized protein LOC100784099 [Glycine max] gi|571514023|ref|XP_006597004.1| PREDICTED: uncharacterized protein LOC100784099 isoform X1 [Glycine max] gi|255637109|gb|ACU18886.1| unknown [Glycine max] Length = 466 Score = 63.9 bits (154), Expect = 6e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 122 LIEVGTTMNPTLTHADRLVGQVLGEVGSLLEVFVELKV 235 LI VGTTM+PTLT ADRLVGQVLGEVGSL EVFVEL+V Sbjct: 328 LIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVFVELEV 365 >gb|ACU18507.1| unknown [Glycine max] Length = 383 Score = 63.9 bits (154), Expect = 6e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 122 LIEVGTTMNPTLTHADRLVGQVLGEVGSLLEVFVELKV 235 LI VGTTM+PTLT ADRLVGQVLGEVGSL EVFVEL+V Sbjct: 238 LIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVFVELEV 275 >ref|XP_007209433.1| hypothetical protein PRUPE_ppa009587mg [Prunus persica] gi|462405168|gb|EMJ10632.1| hypothetical protein PRUPE_ppa009587mg [Prunus persica] Length = 286 Score = 63.5 bits (153), Expect = 8e-08 Identities = 33/56 (58%), Positives = 42/56 (75%) Frame = +2 Query: 122 LIEVGTTMNPTLTHADRLVGQVLGEVGSLLEVFVELKVRS*TCKISFTILHLYLLM 289 LI VGTTM+PTLT ADRLVGQVLGEVGSL EVFVEL+ C + +++ ++ + Sbjct: 136 LIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVFVELEQIEQICVCASSVMSKFVFV 191 >ref|XP_006663865.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 3-like [Oryza brachyantha] Length = 464 Score = 63.2 bits (152), Expect = 1e-07 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +2 Query: 110 VLVSLIEVGTTMNPTLTHADRLVGQVLGEVGSLLEVFVELKV 235 VL LI VGTTM+PTLT ADRLVGQVLGEVGSL +V+VEL++ Sbjct: 324 VLGGLIGVGTTMDPTLTRADRLVGQVLGEVGSLPDVYVELEI 365