BLASTX nr result
ID: Akebia23_contig00017720
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00017720 (246 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007222503.1| hypothetical protein PRUPE_ppa008283mg [Prun... 61 2e-07 ref|XP_006438426.1| hypothetical protein CICLE_v10031988mg [Citr... 58 1e-06 ref|XP_006438425.1| hypothetical protein CICLE_v10031988mg [Citr... 58 1e-06 ref|XP_004297643.1| PREDICTED: spermidine synthase 1-like [Fraga... 57 2e-06 ref|XP_002534321.1| spermidine synthase 1, putative [Ricinus com... 56 5e-06 dbj|BAC20171.1| spermidine synthase [Malus domestica] 55 8e-06 >ref|XP_007222503.1| hypothetical protein PRUPE_ppa008283mg [Prunus persica] gi|462419439|gb|EMJ23702.1| hypothetical protein PRUPE_ppa008283mg [Prunus persica] Length = 338 Score = 60.8 bits (146), Expect = 2e-07 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 1/60 (1%) Frame = -3 Query: 178 GASDLLVKQSREDEVVREKNEENGVFDSS-VAVEMDIGKELEYISSVIPG*FSEISPMWP 2 G++D +K+SRE+E ENGV+ +S V+VE D GKE + +S+VIPG FSEISPMWP Sbjct: 8 GSADFPLKRSREEE-------ENGVYAASTVSVETDTGKEADGVSAVIPGWFSEISPMWP 60 >ref|XP_006438426.1| hypothetical protein CICLE_v10031988mg [Citrus clementina] gi|557540622|gb|ESR51666.1| hypothetical protein CICLE_v10031988mg [Citrus clementina] Length = 319 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/61 (52%), Positives = 39/61 (63%) Frame = -3 Query: 184 SVGASDLLVKQSREDEVVREKNEENGVFDSSVAVEMDIGKELEYISSVIPG*FSEISPMW 5 S A+DL +K+ R+D N NG SV +EMD K+ + ISSVIPG FSEISPMW Sbjct: 6 SAAATDLPLKRPRDDGEKEANNNNNG----SVLMEMDSNKQPDCISSVIPGWFSEISPMW 61 Query: 4 P 2 P Sbjct: 62 P 62 >ref|XP_006438425.1| hypothetical protein CICLE_v10031988mg [Citrus clementina] gi|568860644|ref|XP_006483825.1| PREDICTED: spermidine synthase-like [Citrus sinensis] gi|557540621|gb|ESR51665.1| hypothetical protein CICLE_v10031988mg [Citrus clementina] Length = 345 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/61 (52%), Positives = 39/61 (63%) Frame = -3 Query: 184 SVGASDLLVKQSREDEVVREKNEENGVFDSSVAVEMDIGKELEYISSVIPG*FSEISPMW 5 S A+DL +K+ R+D N NG SV +EMD K+ + ISSVIPG FSEISPMW Sbjct: 6 SAAATDLPLKRPRDDGEKEANNNNNG----SVLMEMDSNKQPDCISSVIPGWFSEISPMW 61 Query: 4 P 2 P Sbjct: 62 P 62 >ref|XP_004297643.1| PREDICTED: spermidine synthase 1-like [Fragaria vesca subsp. vesca] Length = 336 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/60 (51%), Positives = 39/60 (65%) Frame = -3 Query: 181 VGASDLLVKQSREDEVVREKNEENGVFDSSVAVEMDIGKELEYISSVIPG*FSEISPMWP 2 VG D VK++RE+E ENG ++ A+E + GKE + IS VIPG FSEISPMWP Sbjct: 7 VGLGDFPVKRAREEE-------ENGGLTAAAAMETESGKEPDCISGVIPGWFSEISPMWP 59 >ref|XP_002534321.1| spermidine synthase 1, putative [Ricinus communis] gi|223525495|gb|EEF28057.1| spermidine synthase 1, putative [Ricinus communis] Length = 346 Score = 56.2 bits (134), Expect = 5e-06 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 3/63 (4%) Frame = -3 Query: 181 VGASDLLVKQSREDEVVREKNEENGVFDSSVAVEMDIG---KELEYISSVIPG*FSEISP 11 V +DL VK+ REDE+ ENGV ++ AV MD +YISSVIPG FSEISP Sbjct: 10 VSNNDLPVKRPREDEL----EIENGVSSATTAVAMDTEGNTSNSDYISSVIPGWFSEISP 65 Query: 10 MWP 2 MWP Sbjct: 66 MWP 68 >dbj|BAC20171.1| spermidine synthase [Malus domestica] Length = 335 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/62 (51%), Positives = 43/62 (69%), Gaps = 2/62 (3%) Frame = -3 Query: 181 VGASDLLVKQSREDEVVREKNEENGV--FDSSVAVEMDIGKELEYISSVIPG*FSEISPM 8 VG++DL +K+ RE+E ENG S+V++E D GKE + +S+VIPG FSEISPM Sbjct: 7 VGSADLPLKRPREEE-------ENGAEAAASAVSMETDGGKEPDSVSAVIPGWFSEISPM 59 Query: 7 WP 2 WP Sbjct: 60 WP 61