BLASTX nr result
ID: Akebia23_contig00017582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00017582 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320293.2| hypothetical protein POPTR_0014s11480g [Popu... 56 6e-06 ref|XP_002302770.1| NUCLEAR ENCODED CLP PROTEASE 1 family protei... 56 6e-06 >ref|XP_002320293.2| hypothetical protein POPTR_0014s11480g [Populus trichocarpa] gi|550323994|gb|EEE98608.2| hypothetical protein POPTR_0014s11480g [Populus trichocarpa] Length = 306 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 298 AKEAKEYGLIDGVILNPLKVLHPLAAIADQ 209 AKEAK+YGLIDGVILNPLKVL PLAA ADQ Sbjct: 276 AKEAKDYGLIDGVILNPLKVLQPLAAAADQ 305 >ref|XP_002302770.1| NUCLEAR ENCODED CLP PROTEASE 1 family protein [Populus trichocarpa] gi|222844496|gb|EEE82043.1| NUCLEAR ENCODED CLP PROTEASE 1 family protein [Populus trichocarpa] Length = 300 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 298 AKEAKEYGLIDGVILNPLKVLHPLAAIADQ 209 AKEAK+YGLIDGVILNPLKVL PLAA ADQ Sbjct: 270 AKEAKDYGLIDGVILNPLKVLQPLAAAADQ 299