BLASTX nr result
ID: Akebia23_contig00017335
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00017335 (1084 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADN34235.1| hypothetical protein [Cucumis melo subsp. melo] 59 5e-06 >gb|ADN34235.1| hypothetical protein [Cucumis melo subsp. melo] Length = 51 Score = 58.5 bits (140), Expect = 5e-06 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = -1 Query: 163 ICLTYLMAEVTHFKQADGEFRGHEDTLYSEPGGVMDYEED 44 +CLTY++AEVT+ KQA+ + R HE+ +YSEPGGVMDYEED Sbjct: 1 MCLTYIVAEVTNCKQANIDIREHEE-IYSEPGGVMDYEED 39