BLASTX nr result
ID: Akebia23_contig00017296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00017296 (458 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC34905.1| Histidine kinase 2 [Morus notabilis] 55 8e-06 ref|XP_006447749.1| hypothetical protein CICLE_v10014068mg [Citr... 55 8e-06 ref|XP_007049296.1| Histidine kinase 2 isoform 3 [Theobroma caca... 55 8e-06 ref|XP_007049295.1| CHASE domain containing histidine kinase pro... 55 8e-06 ref|XP_007049294.1| CHASE domain containing histidine kinase pro... 55 8e-06 ref|XP_002269977.2| PREDICTED: histidine kinase 2-like [Vitis vi... 55 8e-06 emb|CBI28424.3| unnamed protein product [Vitis vinifera] 55 8e-06 ref|XP_002531702.1| histidine kinase 1, 2, 3 plant, putative [Ri... 55 8e-06 emb|CAN76309.1| hypothetical protein VITISV_028333 [Vitis vinifera] 55 8e-06 >gb|EXC34905.1| Histidine kinase 2 [Morus notabilis] Length = 1326 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 365 ENIGKYTERTGFERPLTSGVAYALKVVHSER 457 + G+YTERT FERPLTSGVAYALKV+HSER Sbjct: 411 KTFGEYTERTAFERPLTSGVAYALKVLHSER 441 >ref|XP_006447749.1| hypothetical protein CICLE_v10014068mg [Citrus clementina] gi|567910873|ref|XP_006447750.1| hypothetical protein CICLE_v10014068mg [Citrus clementina] gi|568830457|ref|XP_006469515.1| PREDICTED: histidine kinase 2-like [Citrus sinensis] gi|557550360|gb|ESR60989.1| hypothetical protein CICLE_v10014068mg [Citrus clementina] gi|557550361|gb|ESR60990.1| hypothetical protein CICLE_v10014068mg [Citrus clementina] Length = 1223 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 365 ENIGKYTERTGFERPLTSGVAYALKVVHSER 457 + G+YTERT FERPLTSGVAYALKV+HSER Sbjct: 343 KTFGEYTERTAFERPLTSGVAYALKVLHSER 373 >ref|XP_007049296.1| Histidine kinase 2 isoform 3 [Theobroma cacao] gi|508701557|gb|EOX93453.1| Histidine kinase 2 isoform 3 [Theobroma cacao] Length = 1047 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 365 ENIGKYTERTGFERPLTSGVAYALKVVHSER 457 + G+YTERT FERPLTSGVAYALKV+HSER Sbjct: 165 KTFGEYTERTAFERPLTSGVAYALKVLHSER 195 >ref|XP_007049295.1| CHASE domain containing histidine kinase protein, putative isoform 2 [Theobroma cacao] gi|508701556|gb|EOX93452.1| CHASE domain containing histidine kinase protein, putative isoform 2 [Theobroma cacao] Length = 1271 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 365 ENIGKYTERTGFERPLTSGVAYALKVVHSER 457 + G+YTERT FERPLTSGVAYALKV+HSER Sbjct: 389 KTFGEYTERTAFERPLTSGVAYALKVLHSER 419 >ref|XP_007049294.1| CHASE domain containing histidine kinase protein, putative isoform 1 [Theobroma cacao] gi|508701555|gb|EOX93451.1| CHASE domain containing histidine kinase protein, putative isoform 1 [Theobroma cacao] Length = 1314 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 365 ENIGKYTERTGFERPLTSGVAYALKVVHSER 457 + G+YTERT FERPLTSGVAYALKV+HSER Sbjct: 389 KTFGEYTERTAFERPLTSGVAYALKVLHSER 419 >ref|XP_002269977.2| PREDICTED: histidine kinase 2-like [Vitis vinifera] Length = 1272 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 365 ENIGKYTERTGFERPLTSGVAYALKVVHSER 457 + G+YTERT FERPLTSGVAYALKV+HSER Sbjct: 390 KTFGEYTERTAFERPLTSGVAYALKVLHSER 420 >emb|CBI28424.3| unnamed protein product [Vitis vinifera] Length = 1203 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 365 ENIGKYTERTGFERPLTSGVAYALKVVHSER 457 + G+YTERT FERPLTSGVAYALKV+HSER Sbjct: 363 KTFGEYTERTAFERPLTSGVAYALKVLHSER 393 >ref|XP_002531702.1| histidine kinase 1, 2, 3 plant, putative [Ricinus communis] gi|223528678|gb|EEF30693.1| histidine kinase 1, 2, 3 plant, putative [Ricinus communis] Length = 922 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 365 ENIGKYTERTGFERPLTSGVAYALKVVHSER 457 + G+YTERT FERPLTSGVAYALKV+HSER Sbjct: 40 KTFGEYTERTAFERPLTSGVAYALKVLHSER 70 >emb|CAN76309.1| hypothetical protein VITISV_028333 [Vitis vinifera] Length = 1400 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 365 ENIGKYTERTGFERPLTSGVAYALKVVHSER 457 + G+YTERT FERPLTSGVAYALKV+HSER Sbjct: 429 KTFGEYTERTAFERPLTSGVAYALKVLHSER 459