BLASTX nr result
ID: Akebia23_contig00017193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00017193 (264 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006477551.1| PREDICTED: cytochrome P450 71A1-like [Citrus... 66 6e-09 ref|XP_006439948.1| hypothetical protein CICLE_v10019797mg [Citr... 65 8e-09 ref|XP_006485812.1| PREDICTED: cytochrome P450 71A1-like [Citrus... 63 4e-08 ref|XP_006442623.1| hypothetical protein CICLE_v10019648mg [Citr... 63 4e-08 ref|XP_002323083.2| hypothetical protein POPTR_0016s14460g [Popu... 63 5e-08 ref|XP_002323081.2| hypothetical protein POPTR_0016s14440g [Popu... 63 5e-08 ref|XP_006469219.1| PREDICTED: cytochrome P450 71A1-like [Citrus... 62 1e-07 ref|XP_006448203.1| hypothetical protein CICLE_v10018132mg [Citr... 62 1e-07 gb|EXB99731.1| Cytochrome P450 71A1 [Morus notabilis] 61 1e-07 ref|XP_006442630.1| hypothetical protein CICLE_v10023290mg [Citr... 61 1e-07 ref|XP_006477906.1| PREDICTED: cytochrome P450 71A1-like [Citrus... 61 2e-07 ref|XP_006477550.1| PREDICTED: cytochrome P450 71A1-like [Citrus... 60 2e-07 ref|XP_006439947.1| hypothetical protein CICLE_v10023920mg [Citr... 60 2e-07 ref|XP_002322207.1| hypothetical protein POPTR_0015s09720g [Popu... 60 3e-07 ref|XP_006442626.1| hypothetical protein CICLE_v10024587mg [Citr... 59 5e-07 ref|XP_006442419.1| hypothetical protein CICLE_v10019789mg [Citr... 59 5e-07 ref|XP_006439949.1| hypothetical protein CICLE_v10024573mg, part... 59 7e-07 sp|P24465.2|C71A1_PERAE RecName: Full=Cytochrome P450 71A1; AltN... 59 9e-07 ref|XP_006442622.1| hypothetical protein CICLE_v10024390mg [Citr... 58 1e-06 gb|EXB94470.1| Cytochrome P450 71A1 [Morus notabilis] 58 2e-06 >ref|XP_006477551.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis] Length = 505 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 262 ANLLYWFDWDLPNSANKEELDMTEASGIVVNKKIPLLLVPTVH 134 ANLLYWFDW LP A E+LDMTE G+ V+KK PL+LVPT++ Sbjct: 461 ANLLYWFDWKLPGGAVNEDLDMTEVFGLTVSKKFPLILVPTLY 503 >ref|XP_006439948.1| hypothetical protein CICLE_v10019797mg [Citrus clementina] gi|557542210|gb|ESR53188.1| hypothetical protein CICLE_v10019797mg [Citrus clementina] Length = 505 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 262 ANLLYWFDWDLPNSANKEELDMTEASGIVVNKKIPLLLVPTVH 134 ANLLYWFDW LP A E+LDMTE G+ V+KK PL+LVPT++ Sbjct: 461 ANLLYWFDWKLPGGAVNEDLDMTEVFGLTVSKKYPLILVPTLY 503 >ref|XP_006485812.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis] Length = 536 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = -3 Query: 262 ANLLYWFDWDLPNSANKEELDMTEASGIVVNKKIPLLLVPTVH 134 ANLLYWFDW+LP +E LDM+E +G+VV+KK+PL LVPT++ Sbjct: 490 ANLLYWFDWNLPLGEVEENLDMSEVNGLVVHKKLPLHLVPTLY 532 >ref|XP_006442623.1| hypothetical protein CICLE_v10019648mg [Citrus clementina] gi|557544885|gb|ESR55863.1| hypothetical protein CICLE_v10019648mg [Citrus clementina] Length = 536 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = -3 Query: 262 ANLLYWFDWDLPNSANKEELDMTEASGIVVNKKIPLLLVPTVH 134 ANLLYWFDW+LP +E LDM+E +G+VV+KK+PL LVPT++ Sbjct: 490 ANLLYWFDWNLPLGEVEENLDMSEVNGLVVHKKLPLHLVPTLY 532 >ref|XP_002323083.2| hypothetical protein POPTR_0016s14460g [Populus trichocarpa] gi|550321504|gb|EEF04844.2| hypothetical protein POPTR_0016s14460g [Populus trichocarpa] Length = 486 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -3 Query: 262 ANLLYWFDWDLPNSANKEELDMTEASGIVVNKKIPLLLVPTVH 134 ANLLYWFDW LP+ A +EELDM+E G+ KK PLLLVP+++ Sbjct: 442 ANLLYWFDWRLPDGATQEELDMSEICGMTAYKKTPLLLVPSLY 484 >ref|XP_002323081.2| hypothetical protein POPTR_0016s14440g [Populus trichocarpa] gi|550321502|gb|EEF04842.2| hypothetical protein POPTR_0016s14440g [Populus trichocarpa] Length = 523 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -3 Query: 262 ANLLYWFDWDLPNSANKEELDMTEASGIVVNKKIPLLLVPTVH 134 ANLLYWFDW LP+ A +EELDM+E G+ KK PLLLVP+++ Sbjct: 479 ANLLYWFDWRLPDGATQEELDMSEICGMTAYKKTPLLLVPSLY 521 >ref|XP_006469219.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis] Length = 524 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = -3 Query: 262 ANLLYWFDWDLPNSANKEELDMTEASGIVVNKKIPLLLVPTVH 134 AN+LYWFDW LP+ +E LDM+EA+G+ + +K PLL+VPTV+ Sbjct: 480 ANILYWFDWKLPDGPVEENLDMSEATGLTLQRKSPLLVVPTVY 522 >ref|XP_006448203.1| hypothetical protein CICLE_v10018132mg [Citrus clementina] gi|557550814|gb|ESR61443.1| hypothetical protein CICLE_v10018132mg [Citrus clementina] Length = 524 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = -3 Query: 262 ANLLYWFDWDLPNSANKEELDMTEASGIVVNKKIPLLLVPTVH 134 AN+LYWFDW LP+ +E LDM+EA+G+ + +K PLL+VPTV+ Sbjct: 480 ANILYWFDWKLPDGPVEENLDMSEATGLTLQRKSPLLVVPTVY 522 >gb|EXB99731.1| Cytochrome P450 71A1 [Morus notabilis] Length = 515 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -3 Query: 262 ANLLYWFDWDLPNSANKEELDMTEASGIVVNKKIPLLLVP 143 ANLLYWFDW LP +E+LDM+E GIVV+KK+PL LVP Sbjct: 472 ANLLYWFDWKLPAGEKEEDLDMSEVYGIVVHKKLPLHLVP 511 >ref|XP_006442630.1| hypothetical protein CICLE_v10023290mg [Citrus clementina] gi|557544892|gb|ESR55870.1| hypothetical protein CICLE_v10023290mg [Citrus clementina] Length = 242 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -3 Query: 262 ANLLYWFDWDLPNSANKEELDMTEASGIVVNKKIPLLLVPTV 137 ANLLYWFDW+LP +E LDM E +G+VV+KK+PL LVPT+ Sbjct: 196 ANLLYWFDWNLPLGEVEENLDMFEVNGLVVHKKLPLHLVPTL 237 >ref|XP_006477906.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis] Length = 794 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = -3 Query: 262 ANLLYWFDWDLPNSANKEELDMTEASGIVVNKKIPLLLVPTVH 134 ANLLYWFDW LP A LDMTE G+ V KK PL+L+PT++ Sbjct: 750 ANLLYWFDWKLPGGAVDANLDMTEEYGLAVTKKYPLILIPTLY 792 >ref|XP_006477550.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis] Length = 511 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = -3 Query: 262 ANLLYWFDWDLPNSANKEELDMTEASGIVVNKKIPLLLVPTVH 134 ANLLYWFDW LP E+LDMTE G+ V KKIPL LVP ++ Sbjct: 467 ANLLYWFDWKLPGDTVGEDLDMTETFGLTVFKKIPLYLVPVMY 509 >ref|XP_006439947.1| hypothetical protein CICLE_v10023920mg [Citrus clementina] gi|557542209|gb|ESR53187.1| hypothetical protein CICLE_v10023920mg [Citrus clementina] Length = 511 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = -3 Query: 262 ANLLYWFDWDLPNSANKEELDMTEASGIVVNKKIPLLLVPTVH 134 ANLLYWFDW LP E+LDMTE G+ V KKIPL LVP ++ Sbjct: 467 ANLLYWFDWKLPGDTVGEDLDMTETFGLTVFKKIPLYLVPVMY 509 >ref|XP_002322207.1| hypothetical protein POPTR_0015s09720g [Populus trichocarpa] gi|222869203|gb|EEF06334.1| hypothetical protein POPTR_0015s09720g [Populus trichocarpa] Length = 494 Score = 60.1 bits (144), Expect = 3e-07 Identities = 22/42 (52%), Positives = 34/42 (80%) Frame = -3 Query: 262 ANLLYWFDWDLPNSANKEELDMTEASGIVVNKKIPLLLVPTV 137 ANLLYWFDW++P+ N E++DM+E+ +++ KK PL+LVP + Sbjct: 450 ANLLYWFDWNIPHGGNPEDMDMSESHTLIIRKKTPLVLVPVM 491 >ref|XP_006442626.1| hypothetical protein CICLE_v10024587mg [Citrus clementina] gi|557544888|gb|ESR55866.1| hypothetical protein CICLE_v10024587mg [Citrus clementina] Length = 395 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -3 Query: 262 ANLLYWFDWDLPNSANKEELDMTEASGIVVNKKIPLLLVPTVH 134 ANLLYWFDW+LP +E LDM E +G+VV+KK+PL VPT++ Sbjct: 349 ANLLYWFDWNLPLGKVEENLDMFEVNGLVVHKKLPLHPVPTLY 391 >ref|XP_006442419.1| hypothetical protein CICLE_v10019789mg [Citrus clementina] gi|557544681|gb|ESR55659.1| hypothetical protein CICLE_v10019789mg [Citrus clementina] Length = 507 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = -3 Query: 262 ANLLYWFDWDLPNSANKEELDMTEASGIVVNKKIPLLLVPTVH 134 ANLLYWFDW LP A LDMTE G+ V KK PL+L+PT++ Sbjct: 463 ANLLYWFDWKLPGGAVDANLDMTEEYGLAVTKKHPLILMPTLY 505 >ref|XP_006439949.1| hypothetical protein CICLE_v10024573mg, partial [Citrus clementina] gi|557542211|gb|ESR53189.1| hypothetical protein CICLE_v10024573mg, partial [Citrus clementina] Length = 338 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -3 Query: 262 ANLLYWFDWDLPNSANKEELDMTEASGIVVNKKIPLLLVPTVH 134 ANL Y+FDW LP+ A E LDMTE G+ V+KK PLL+VP ++ Sbjct: 290 ANLFYYFDWKLPDGAADESLDMTEVHGLTVHKKFPLLIVPALY 332 >sp|P24465.2|C71A1_PERAE RecName: Full=Cytochrome P450 71A1; AltName: Full=ARP-2; AltName: Full=CYPLXXIA1 gi|166949|gb|AAA32913.1| cytochrome P-450LXXIA1 (cyp71A1) [Persea americana] Length = 502 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = -3 Query: 262 ANLLYWFDWDLPNSANKEELDMTEASGIVVNKKIPLLLVPTVH 134 ANLLYWF+W+LP KE+LDM+EA GI V+ K PL LV H Sbjct: 458 ANLLYWFNWELPGDLTKEDLDMSEAVGITVHMKFPLQLVAKRH 500 >ref|XP_006442622.1| hypothetical protein CICLE_v10024390mg [Citrus clementina] gi|557544884|gb|ESR55862.1| hypothetical protein CICLE_v10024390mg [Citrus clementina] Length = 472 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = -3 Query: 262 ANLLYWFDWDLPNSANKEELDMTEASGIVVNKKIPLLLVPTVH 134 ANLLYWFDW LP E LDM E SG+ V+KK+ L LVPT++ Sbjct: 426 ANLLYWFDWKLPRGEVLENLDMIEVSGLAVHKKLALHLVPTLY 468 >gb|EXB94470.1| Cytochrome P450 71A1 [Morus notabilis] Length = 516 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/45 (51%), Positives = 32/45 (71%) Frame = -3 Query: 262 ANLLYWFDWDLPNSANKEELDMTEASGIVVNKKIPLLLVPTVHFY 128 ANLL WFDW LP EE DM+++ G+V+ +K+PL LVP +H + Sbjct: 470 ANLLCWFDWKLPPGQTVEEFDMSDSFGLVIRRKVPLRLVPIIHSF 514