BLASTX nr result
ID: Akebia23_contig00016828
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00016828 (244 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS83047.1| Protein bli-3 [Pestalotiopsis fici W106-1] 61 1e-07 gb|EHK97289.1| putative protein bli-3 [Glarea lozoyensis 74030] ... 56 6e-06 >gb|ETS83047.1| Protein bli-3 [Pestalotiopsis fici W106-1] Length = 205 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 139 MSSFSNTDTGSKPADPYKAANIDEPSIEEKFQALD 243 MSSFSNT+TGSKPADPY A N DEPS++EKF ALD Sbjct: 1 MSSFSNTNTGSKPADPYTATNKDEPSLQEKFTALD 35 >gb|EHK97289.1| putative protein bli-3 [Glarea lozoyensis 74030] gi|512202561|gb|EPE31388.1| FMN-binding split barrel [Glarea lozoyensis ATCC 20868] Length = 208 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 145 SFSNTDTGSKPADPYKAANIDEPSIEEKFQAL 240 SFSNTDTGSKPADPYKA NIDE S++EK Q L Sbjct: 2 SFSNTDTGSKPADPYKAKNIDEVSLQEKVQDL 33