BLASTX nr result
ID: Akebia23_contig00016778
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00016778 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513198.1| eukaryotic translation initiation factor 3 s... 70 3e-10 ref|XP_007220917.1| hypothetical protein PRUPE_ppa000213mg [Prun... 65 8e-09 ref|XP_002263417.2| PREDICTED: protein KIAA0664 homolog [Vitis v... 64 2e-08 emb|CBI24851.3| unnamed protein product [Vitis vinifera] 64 2e-08 gb|EYU27094.1| hypothetical protein MIMGU_mgv1a000207mg [Mimulus... 63 4e-08 ref|XP_004296673.1| PREDICTED: clustered mitochondria protein-li... 63 5e-08 ref|XP_007052586.1| Tetratricopeptide repeat-containing protein ... 62 6e-08 ref|XP_007052585.1| Tetratricopeptide repeat-containing protein ... 62 6e-08 ref|XP_006482845.1| PREDICTED: clustered mitochondria protein-li... 60 3e-07 ref|XP_006439071.1| hypothetical protein CICLE_v10030514mg [Citr... 60 3e-07 ref|XP_006439070.1| hypothetical protein CICLE_v10030514mg [Citr... 60 3e-07 ref|XP_002314036.2| hypothetical protein POPTR_0009s069801g, par... 60 3e-07 gb|EPS67381.1| hypothetical protein M569_07392, partial [Genlise... 59 5e-07 ref|XP_006850098.1| hypothetical protein AMTR_s00022p00221290 [A... 59 7e-07 ref|XP_007149054.1| hypothetical protein PHAVU_005G037000g [Phas... 58 1e-06 ref|XP_003599087.1| hypothetical protein MTR_3g027610 [Medicago ... 58 1e-06 ref|XP_006292320.1| hypothetical protein CARUB_v10018531mg [Caps... 57 2e-06 gb|EMT25535.1| hypothetical protein F775_27532 [Aegilops tauschii] 57 4e-06 gb|EXB93784.1| Protein KIAA0664-like protein [Morus notabilis] 56 5e-06 ref|XP_006403838.1| hypothetical protein EUTSA_v10010065mg [Eutr... 56 5e-06 >ref|XP_002513198.1| eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] gi|223547696|gb|EEF49189.1| eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] Length = 1424 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -1 Query: 135 DILRESQDKDLGPAIAHFLNCFFGHSQPVGPKGTSNGIQSRTQKK 1 D+LR+++D+DLGP I+HF NCFFG+ Q VG KG SNG Q RTQKK Sbjct: 863 DVLRDTEDQDLGPVISHFFNCFFGNCQAVGAKGGSNGSQPRTQKK 907 >ref|XP_007220917.1| hypothetical protein PRUPE_ppa000213mg [Prunus persica] gi|462417379|gb|EMJ22116.1| hypothetical protein PRUPE_ppa000213mg [Prunus persica] Length = 1454 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -1 Query: 135 DILRESQDKDLGPAIAHFLNCFFGHSQPVGPKGTSNGIQSRTQKK 1 D LRE+ D D+GPAI+HF NCFFG SQ VG K +N +QSRT KK Sbjct: 893 DALRETDDHDIGPAISHFFNCFFGSSQAVGSKVAANSVQSRTPKK 937 >ref|XP_002263417.2| PREDICTED: protein KIAA0664 homolog [Vitis vinifera] Length = 1442 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -1 Query: 135 DILRESQDKDLGPAIAHFLNCFFGHSQPVGPKGTSNGIQSRTQKK 1 D+LR ++D D+GPAI+HF NCFFG Q VG K T+N Q+RT KK Sbjct: 864 DVLRNTEDHDIGPAISHFFNCFFGSYQAVGVKATANSTQARTSKK 908 >emb|CBI24851.3| unnamed protein product [Vitis vinifera] Length = 1445 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -1 Query: 135 DILRESQDKDLGPAIAHFLNCFFGHSQPVGPKGTSNGIQSRTQKK 1 D+LR ++D D+GPAI+HF NCFFG Q VG K T+N Q+RT KK Sbjct: 867 DVLRNTEDHDIGPAISHFFNCFFGSYQAVGVKATANSTQARTSKK 911 >gb|EYU27094.1| hypothetical protein MIMGU_mgv1a000207mg [Mimulus guttatus] Length = 1431 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = -1 Query: 135 DILRESQDKDLGPAIAHFLNCFFGHSQPVGPKGTSNGIQSRTQKK 1 DILR+++D DLG AI+HF NCF G Q V PKG +N QS+TQKK Sbjct: 859 DILRDTEDHDLGHAISHFFNCFLGKVQTVSPKGAANNSQSKTQKK 903 >ref|XP_004296673.1| PREDICTED: clustered mitochondria protein-like [Fragaria vesca subsp. vesca] Length = 1408 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -1 Query: 135 DILRESQDKDLGPAIAHFLNCFFGHSQPVGPKGTSNGIQSRTQKK 1 D+LR+++D D+GPAI HF NCFFG +Q VG K T+N QSR KK Sbjct: 846 DVLRDTEDHDIGPAICHFFNCFFGSNQAVGSKVTANSSQSRIPKK 890 >ref|XP_007052586.1| Tetratricopeptide repeat-containing protein isoform 2, partial [Theobroma cacao] gi|508704847|gb|EOX96743.1| Tetratricopeptide repeat-containing protein isoform 2, partial [Theobroma cacao] Length = 1350 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = -1 Query: 135 DILRESQDKDLGPAIAHFLNCFFGHSQPVGPKGTSNGIQSRTQKK 1 D+LR+++D DLGPAI+HFLNCFFG Q VG K TS+ +QS+ QKK Sbjct: 867 DVLRDTEDHDLGPAISHFLNCFFGSCQAVGAKLTSS-VQSKNQKK 910 >ref|XP_007052585.1| Tetratricopeptide repeat-containing protein isoform 1 [Theobroma cacao] gi|508704846|gb|EOX96742.1| Tetratricopeptide repeat-containing protein isoform 1 [Theobroma cacao] Length = 1428 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = -1 Query: 135 DILRESQDKDLGPAIAHFLNCFFGHSQPVGPKGTSNGIQSRTQKK 1 D+LR+++D DLGPAI+HFLNCFFG Q VG K TS+ +QS+ QKK Sbjct: 867 DVLRDTEDHDLGPAISHFLNCFFGSCQAVGAKLTSS-VQSKNQKK 910 >ref|XP_006482845.1| PREDICTED: clustered mitochondria protein-like [Citrus sinensis] Length = 1422 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = -1 Query: 135 DILRESQDKDLGPAIAHFLNCFFGHSQPVGPKGTSNGIQSRTQKK 1 D+LRE++D DLGPAIAH NCFFG Q V K T++ +QSR Q K Sbjct: 858 DVLRETEDHDLGPAIAHLFNCFFGSCQAVRGKVTASNVQSRNQMK 902 >ref|XP_006439071.1| hypothetical protein CICLE_v10030514mg [Citrus clementina] gi|557541267|gb|ESR52311.1| hypothetical protein CICLE_v10030514mg [Citrus clementina] Length = 1421 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = -1 Query: 135 DILRESQDKDLGPAIAHFLNCFFGHSQPVGPKGTSNGIQSRTQKK 1 D+LRE++D DLGPAIAH NCFFG Q V K T++ +QSR Q K Sbjct: 857 DVLRETEDHDLGPAIAHLFNCFFGSCQAVRGKVTASNVQSRNQMK 901 >ref|XP_006439070.1| hypothetical protein CICLE_v10030514mg [Citrus clementina] gi|557541266|gb|ESR52310.1| hypothetical protein CICLE_v10030514mg [Citrus clementina] Length = 1197 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = -1 Query: 135 DILRESQDKDLGPAIAHFLNCFFGHSQPVGPKGTSNGIQSRTQKK 1 D+LRE++D DLGPAIAH NCFFG Q V K T++ +QSR Q K Sbjct: 633 DVLRETEDHDLGPAIAHLFNCFFGSCQAVRGKVTASNVQSRNQMK 677 >ref|XP_002314036.2| hypothetical protein POPTR_0009s069801g, partial [Populus trichocarpa] gi|550331209|gb|EEE87991.2| hypothetical protein POPTR_0009s069801g, partial [Populus trichocarpa] Length = 798 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = -1 Query: 135 DILRESQDKDLGPAIAHFLNCFFGHSQPVGPKGTSNGIQSRTQKK 1 D+LR++ D DLGPAI+HF NCFFG Q VG K ++NG SR KK Sbjct: 215 DLLRDTDDNDLGPAISHFFNCFFGTCQAVGIKVSANGPHSRAAKK 259 >gb|EPS67381.1| hypothetical protein M569_07392, partial [Genlisea aurea] Length = 991 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -1 Query: 135 DILRESQDKDLGPAIAHFLNCFFGHSQPVGPKGTSNGIQSRTQKK 1 DILR+++D DLG AI+H LNCFFG ++ V KG NG QS+ QKK Sbjct: 478 DILRDTEDHDLGHAISHVLNCFFGKARAVSGKGVVNGSQSKPQKK 522 >ref|XP_006850098.1| hypothetical protein AMTR_s00022p00221290 [Amborella trichopoda] gi|548853696|gb|ERN11679.1| hypothetical protein AMTR_s00022p00221290 [Amborella trichopoda] Length = 1456 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = -1 Query: 135 DILRESQDKDLGPAIAHFLNCFFGHSQPVGPKGTSNGIQSRTQKK 1 D+LR++ D DLG A+AHF NCF H PVG K ++ ++S+TQKK Sbjct: 890 DVLRDTIDHDLGSAVAHFFNCFLRHDVPVGSKNSAGNVRSKTQKK 934 >ref|XP_007149054.1| hypothetical protein PHAVU_005G037000g [Phaseolus vulgaris] gi|561022318|gb|ESW21048.1| hypothetical protein PHAVU_005G037000g [Phaseolus vulgaris] Length = 1434 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = -1 Query: 135 DILRESQDKDLGPAIAHFLNCFFGHSQPVGPKGTSNGIQSRTQKK 1 D+LRE++D DL PA++HFLNC FG Q K T+N QS+T KK Sbjct: 874 DLLRETEDHDLAPAVSHFLNCLFGSCQAPSGKATTNSTQSKTPKK 918 >ref|XP_003599087.1| hypothetical protein MTR_3g027610 [Medicago truncatula] gi|355488135|gb|AES69338.1| hypothetical protein MTR_3g027610 [Medicago truncatula] Length = 1540 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = -1 Query: 135 DILRESQDKDLGPAIAHFLNCFFGHSQPVGPKGTSNGIQSRTQKK 1 D+LRE++D DL PAI+HFLNC FG+ Q G K +N QSRT KK Sbjct: 876 DLLRETEDHDLSPAISHFLNCLFGNCQAFGGKLVTNLTQSRTTKK 920 >ref|XP_006292320.1| hypothetical protein CARUB_v10018531mg [Capsella rubella] gi|482561027|gb|EOA25218.1| hypothetical protein CARUB_v10018531mg [Capsella rubella] Length = 1373 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = -1 Query: 135 DILRESQDKDLGPAIAHFLNCFFGHSQPVGPKGTSNGIQSRTQKK 1 DILR+ +D D+G A+AHFLNCFFG+ Q G K ++N ++ QKK Sbjct: 861 DILRDVEDHDIGSAVAHFLNCFFGNYQAAGGKASTNSSNAKNQKK 905 >gb|EMT25535.1| hypothetical protein F775_27532 [Aegilops tauschii] Length = 1336 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = -1 Query: 135 DILRESQDKDLGPAIAHFLNCFFGHSQPVGPKGTSNGIQSRTQKK 1 DILR+S D ++ PA+AHFLNCFFG KG++ QS+TQKK Sbjct: 859 DILRQSPDHNIAPAVAHFLNCFFGKVLAASSKGSTGSPQSKTQKK 903 >gb|EXB93784.1| Protein KIAA0664-like protein [Morus notabilis] Length = 1398 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/45 (55%), Positives = 30/45 (66%) Frame = -1 Query: 135 DILRESQDKDLGPAIAHFLNCFFGHSQPVGPKGTSNGIQSRTQKK 1 D LRE++D DLGPAI+HF NC FG Q V KG + SRT +K Sbjct: 836 DALRETEDHDLGPAISHFFNCLFGSCQAVSTKGAAGSPHSRTPRK 880 >ref|XP_006403838.1| hypothetical protein EUTSA_v10010065mg [Eutrema salsugineum] gi|557104957|gb|ESQ45291.1| hypothetical protein EUTSA_v10010065mg [Eutrema salsugineum] Length = 1383 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/45 (51%), Positives = 33/45 (73%) Frame = -1 Query: 135 DILRESQDKDLGPAIAHFLNCFFGHSQPVGPKGTSNGIQSRTQKK 1 DILRE +D D+G A++HFLNCFFG+ G K ++N + ++ QKK Sbjct: 851 DILREIEDHDIGAAVSHFLNCFFGNYVAAGGKASTNSLHAKNQKK 895