BLASTX nr result
ID: Akebia23_contig00016773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00016773 (442 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315327.1| hypothetical protein POPTR_0010s23520g [Popu... 56 6e-06 >ref|XP_002315327.1| hypothetical protein POPTR_0010s23520g [Populus trichocarpa] gi|222864367|gb|EEF01498.1| hypothetical protein POPTR_0010s23520g [Populus trichocarpa] Length = 411 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -2 Query: 441 REWEVYRVLIDDEGDGLSTCHKKIEDGVRNMLMGWE 334 REWEVYR+L+D EGDGL KIE+GVR +LMGWE Sbjct: 377 REWEVYRILLD-EGDGLPVSRNKIEEGVRKVLMGWE 411