BLASTX nr result
ID: Akebia23_contig00016507
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00016507 (398 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004302248.1| PREDICTED: GTP-binding protein SAR1A-like [F... 87 2e-15 ref|XP_007205947.1| hypothetical protein PRUPE_ppa011842mg [Prun... 86 4e-15 ref|XP_007200564.1| hypothetical protein PRUPE_ppa011838mg [Prun... 86 4e-15 ref|XP_004152229.1| PREDICTED: GTP-binding protein SAR1A-like [C... 86 4e-15 ref|XP_002519199.1| GTP-binding protein sar1, putative [Ricinus ... 86 4e-15 ref|NP_192117.1| GTP-binding protein SAR1A [Arabidopsis thaliana... 86 5e-15 gb|EYU46801.1| hypothetical protein MIMGU_mgv1a014316mg [Mimulus... 86 7e-15 gb|EMT00078.1| GTP-binding protein SAR1A [Aegilops tauschii] 85 9e-15 gb|EMS65277.1| GTP-binding protein SAR1A [Triticum urartu] 85 9e-15 dbj|BAJ87173.1| predicted protein [Hordeum vulgare subsp. vulgar... 85 9e-15 dbj|BAJ93856.1| predicted protein [Hordeum vulgare subsp. vulgare] 85 9e-15 ref|XP_002515297.1| GTP-binding protein sar1, putative [Ricinus ... 85 9e-15 ref|XP_006288715.1| hypothetical protein CARUB_v10002026mg [Caps... 85 1e-14 ref|NP_171762.1| Ras-related small GTP-binding protein [Arabidop... 85 1e-14 ref|XP_002889409.1| Os01g0254000 [Arabidopsis lyrata subsp. lyra... 85 1e-14 ref|XP_002874941.1| Os01g0254000 [Arabidopsis lyrata subsp. lyra... 85 1e-14 gb|EXB66050.1| GTP-binding protein [Morus notabilis] 84 2e-14 gb|EXB47146.1| GTP-binding protein [Morus notabilis] 84 2e-14 gb|EXB47144.1| GTP-binding protein [Morus notabilis] gi|58787697... 84 2e-14 ref|XP_006488863.1| PREDICTED: GTP-binding protein SAR1A-like [C... 84 2e-14 >ref|XP_004302248.1| PREDICTED: GTP-binding protein SAR1A-like [Fragaria vesca subsp. vesca] Length = 193 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -3 Query: 396 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 277 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK Sbjct: 154 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 193 >ref|XP_007205947.1| hypothetical protein PRUPE_ppa011842mg [Prunus persica] gi|462401589|gb|EMJ07146.1| hypothetical protein PRUPE_ppa011842mg [Prunus persica] Length = 193 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 396 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 277 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKW+SQYIK Sbjct: 154 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 193 >ref|XP_007200564.1| hypothetical protein PRUPE_ppa011838mg [Prunus persica] gi|462395964|gb|EMJ01763.1| hypothetical protein PRUPE_ppa011838mg [Prunus persica] Length = 193 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 396 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 277 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKW+SQYIK Sbjct: 154 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 193 >ref|XP_004152229.1| PREDICTED: GTP-binding protein SAR1A-like [Cucumis sativus] gi|449524132|ref|XP_004169077.1| PREDICTED: GTP-binding protein SAR1A-like [Cucumis sativus] Length = 193 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 396 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 277 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKW+SQYIK Sbjct: 154 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWMSQYIK 193 >ref|XP_002519199.1| GTP-binding protein sar1, putative [Ricinus communis] gi|223541514|gb|EEF43063.1| GTP-binding protein sar1, putative [Ricinus communis] Length = 193 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 396 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 277 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKW+SQYIK Sbjct: 154 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 193 >ref|NP_192117.1| GTP-binding protein SAR1A [Arabidopsis thaliana] gi|3334323|sp|O04834.1|SAR1A_ARATH RecName: Full=GTP-binding protein SAR1A gi|1314860|gb|AAA99827.1| Sar1 homolog [Arabidopsis thaliana] gi|2104532|gb|AAC78700.1| SAR1/GTP-binding secretory factor [Arabidopsis thaliana] gi|2104550|gb|AAB57799.1| AGAA.4 [Arabidopsis thaliana] gi|7268592|emb|CAB80701.1| SAR1/GTP-binding secretory factor [Arabidopsis thaliana] gi|17529144|gb|AAL38798.1| putative SAR1/GTP-binding secretory factor [Arabidopsis thaliana] gi|20465729|gb|AAM20333.1| putative SAR1/GTP-binding secretory factor [Arabidopsis thaliana] gi|21618030|gb|AAM67080.1| SAR1/GTP-binding secretory factor [Arabidopsis thaliana] gi|332656722|gb|AEE82122.1| GTP-binding protein SAR1A [Arabidopsis thaliana] Length = 193 Score = 85.9 bits (211), Expect = 5e-15 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 396 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 277 GKGKVNLTDSNVRPLEVFMCSIVRKMGYG+GFKWVSQYIK Sbjct: 154 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGEGFKWVSQYIK 193 >gb|EYU46801.1| hypothetical protein MIMGU_mgv1a014316mg [Mimulus guttatus] Length = 193 Score = 85.5 bits (210), Expect = 7e-15 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -3 Query: 396 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 277 GKGKVNL DSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK Sbjct: 154 GKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 193 >gb|EMT00078.1| GTP-binding protein SAR1A [Aegilops tauschii] Length = 136 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 396 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 277 GKGKVNL DSNVRPLEVFMCS+VRKMGYGDGFKWVSQYIK Sbjct: 97 GKGKVNLVDSNVRPLEVFMCSVVRKMGYGDGFKWVSQYIK 136 >gb|EMS65277.1| GTP-binding protein SAR1A [Triticum urartu] Length = 186 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 396 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 277 GKGKVNL DSNVRPLEVFMCS+VRKMGYGDGFKWVSQYIK Sbjct: 147 GKGKVNLVDSNVRPLEVFMCSVVRKMGYGDGFKWVSQYIK 186 >dbj|BAJ87173.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326514012|dbj|BAJ92156.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 193 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 396 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 277 GKGKVNL DSNVRPLEVFMCS+VRKMGYGDGFKWVSQYIK Sbjct: 154 GKGKVNLVDSNVRPLEVFMCSVVRKMGYGDGFKWVSQYIK 193 >dbj|BAJ93856.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 193 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 396 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 277 GKGKVNL DSNVRPLEVFMCS+VRKMGYGDGFKWVSQYIK Sbjct: 154 GKGKVNLVDSNVRPLEVFMCSVVRKMGYGDGFKWVSQYIK 193 >ref|XP_002515297.1| GTP-binding protein sar1, putative [Ricinus communis] gi|223545777|gb|EEF47281.1| GTP-binding protein sar1, putative [Ricinus communis] Length = 193 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -3 Query: 396 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 277 GKGKVNLTD+NVRPLEVFMCSIVRKMGYGDGFKW+SQYIK Sbjct: 154 GKGKVNLTDTNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 193 >ref|XP_006288715.1| hypothetical protein CARUB_v10002026mg [Capsella rubella] gi|482557421|gb|EOA21613.1| hypothetical protein CARUB_v10002026mg [Capsella rubella] Length = 193 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -3 Query: 396 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 277 GKGKVNLTDSNVRPLEVFMCSIVRKMGYG+GFKW+SQYIK Sbjct: 154 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGEGFKWLSQYIK 193 >ref|NP_171762.1| Ras-related small GTP-binding protein [Arabidopsis thaliana] gi|332189329|gb|AEE27450.1| Ras-related small GTP-binding protein [Arabidopsis thaliana] Length = 122 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -3 Query: 396 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 277 GKGKVNLTDSNVRPLEVFMCSIVRKMGYG+GFKW+SQYIK Sbjct: 83 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGEGFKWLSQYIK 122 >ref|XP_002889409.1| Os01g0254000 [Arabidopsis lyrata subsp. lyrata] gi|565496030|ref|XP_006305654.1| hypothetical protein CARUB_v10010357mg [Capsella rubella] gi|567156304|ref|XP_006418323.1| hypothetical protein EUTSA_v10008842mg [Eutrema salsugineum] gi|297335251|gb|EFH65668.1| Os01g0254000 [Arabidopsis lyrata subsp. lyrata] gi|482574365|gb|EOA38552.1| hypothetical protein CARUB_v10010357mg [Capsella rubella] gi|557096094|gb|ESQ36676.1| hypothetical protein EUTSA_v10008842mg [Eutrema salsugineum] Length = 193 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -3 Query: 396 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 277 GKGKVNLTDSNVRPLEVFMCSIVRKMGYG+GFKW+SQYIK Sbjct: 154 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGEGFKWLSQYIK 193 >ref|XP_002874941.1| Os01g0254000 [Arabidopsis lyrata subsp. lyrata] gi|297320778|gb|EFH51200.1| Os01g0254000 [Arabidopsis lyrata subsp. lyrata] Length = 193 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -3 Query: 396 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 277 GKGKVNLTDSNVRPLEVFMCSIVRKMGYG+GFKW+SQYIK Sbjct: 154 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGEGFKWLSQYIK 193 >gb|EXB66050.1| GTP-binding protein [Morus notabilis] Length = 149 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 396 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 277 GKGKVNL DSNVRPLEVFMCSIVRKMGYGDGFKW+SQYIK Sbjct: 110 GKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 149 >gb|EXB47146.1| GTP-binding protein [Morus notabilis] Length = 189 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 396 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 277 GKGKVNL DSNVRPLEVFMCSIVRKMGYGDGFKW+SQYIK Sbjct: 150 GKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 189 >gb|EXB47144.1| GTP-binding protein [Morus notabilis] gi|587876973|gb|EXB66047.1| GTP-binding protein [Morus notabilis] Length = 193 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 396 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 277 GKGKVNL DSNVRPLEVFMCSIVRKMGYGDGFKW+SQYIK Sbjct: 154 GKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 193 >ref|XP_006488863.1| PREDICTED: GTP-binding protein SAR1A-like [Citrus sinensis] Length = 193 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -3 Query: 396 GKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIK 277 GKGKVNLTDS+VRPLEVFMCSIVRKMGYGDGFKW+SQYIK Sbjct: 154 GKGKVNLTDSSVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 193