BLASTX nr result
ID: Akebia23_contig00016195
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00016195 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531310.1| tRNA-specific adenosine deaminase subunit TA... 60 2e-07 ref|XP_004301162.1| PREDICTED: tRNA-specific adenosine deaminase... 59 5e-07 ref|XP_007154714.1| hypothetical protein PHAVU_003G141300g [Phas... 59 9e-07 ref|XP_006453252.1| hypothetical protein CICLE_v10009594mg [Citr... 59 9e-07 ref|XP_006362464.1| PREDICTED: uncharacterized protein LOC102583... 58 1e-06 ref|XP_004242811.1| PREDICTED: tRNA-specific adenosine deaminase... 58 1e-06 ref|XP_004242810.1| PREDICTED: tRNA-specific adenosine deaminase... 58 1e-06 gb|EXC31213.1| tRNA-specific adenosine deaminase 2 [Morus notabi... 57 3e-06 ref|XP_006474268.1| PREDICTED: tRNA-specific adenosine deaminase... 57 3e-06 ref|XP_006453251.1| hypothetical protein CICLE_v10009594mg [Citr... 57 3e-06 ref|XP_007014421.1| Cytidine/deoxycytidylate deaminase family pr... 57 3e-06 ref|XP_007014418.1| Cytidine/deoxycytidylate deaminase family pr... 57 3e-06 ref|XP_007227178.1| hypothetical protein PRUPE_ppa020315mg [Prun... 57 4e-06 ref|XP_006393469.1| hypothetical protein EUTSA_v10012316mg [Eutr... 55 8e-06 gb|EPS72078.1| hypothetical protein M569_02680, partial [Genlise... 55 8e-06 ref|XP_006305194.1| hypothetical protein CARUB_v10009558mg [Caps... 55 8e-06 ref|NP_564523.3| tRNA adenosine deaminase 1 [Arabidopsis thalian... 55 8e-06 >ref|XP_002531310.1| tRNA-specific adenosine deaminase subunit TAD2, putative [Ricinus communis] gi|223529101|gb|EEF31082.1| tRNA-specific adenosine deaminase subunit TAD2, putative [Ricinus communis] Length = 223 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -3 Query: 374 VLEGKNFKCIGGIMASEAVSLLRSFYEQGNPNA 276 V +GK FKC GGIMASEAVSLLR FYEQGNPNA Sbjct: 177 VAQGKGFKCTGGIMASEAVSLLRCFYEQGNPNA 209 >ref|XP_004301162.1| PREDICTED: tRNA-specific adenosine deaminase 2-like [Fragaria vesca subsp. vesca] Length = 195 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 374 VLEGKNFKCIGGIMASEAVSLLRSFYEQGNPNA 276 V +GK+FKC GGIMASEAVSL R+FYEQGNPNA Sbjct: 150 VPQGKSFKCTGGIMASEAVSLFRNFYEQGNPNA 182 >ref|XP_007154714.1| hypothetical protein PHAVU_003G141300g [Phaseolus vulgaris] gi|561028068|gb|ESW26708.1| hypothetical protein PHAVU_003G141300g [Phaseolus vulgaris] Length = 182 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 377 EVLEGKNFKCIGGIMASEAVSLLRSFYEQGNPNA 276 EV GK+FKC GGIMASEAV L R+FYEQGNPNA Sbjct: 138 EVSSGKSFKCTGGIMASEAVLLFRTFYEQGNPNA 171 >ref|XP_006453252.1| hypothetical protein CICLE_v10009594mg [Citrus clementina] gi|568840631|ref|XP_006474269.1| PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X2 [Citrus sinensis] gi|557556478|gb|ESR66492.1| hypothetical protein CICLE_v10009594mg [Citrus clementina] Length = 191 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 377 EVLEGKNFKCIGGIMASEAVSLLRSFYEQGNPNA 276 +VL K FKC GG+MASEAVSL RSFYEQGNPNA Sbjct: 145 DVLGRKGFKCTGGVMASEAVSLFRSFYEQGNPNA 178 >ref|XP_006362464.1| PREDICTED: uncharacterized protein LOC102583162 [Solanum tuberosum] Length = 293 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -3 Query: 362 KNFKCIGGIMASEAVSLLRSFYEQGNPNA 276 K FKC GGIMASEAVSLLRSFYEQGNPNA Sbjct: 254 KGFKCTGGIMASEAVSLLRSFYEQGNPNA 282 >ref|XP_004242811.1| PREDICTED: tRNA-specific adenosine deaminase 2-like isoform 2 [Solanum lycopersicum] Length = 212 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -3 Query: 362 KNFKCIGGIMASEAVSLLRSFYEQGNPNA 276 K FKC GGIMASEAVSLLRSFYEQGNPNA Sbjct: 173 KGFKCTGGIMASEAVSLLRSFYEQGNPNA 201 >ref|XP_004242810.1| PREDICTED: tRNA-specific adenosine deaminase 2-like isoform 1 [Solanum lycopersicum] Length = 215 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -3 Query: 362 KNFKCIGGIMASEAVSLLRSFYEQGNPNA 276 K FKC GGIMASEAVSLLRSFYEQGNPNA Sbjct: 176 KGFKCTGGIMASEAVSLLRSFYEQGNPNA 204 >gb|EXC31213.1| tRNA-specific adenosine deaminase 2 [Morus notabilis] Length = 191 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 368 EGKNFKCIGGIMASEAVSLLRSFYEQGNPNA 276 +GK FKC GGIMASEA+SL R FYEQGNPNA Sbjct: 148 QGKGFKCRGGIMASEAISLFRGFYEQGNPNA 178 >ref|XP_006474268.1| PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X1 [Citrus sinensis] Length = 233 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 377 EVLEGKNFKCIGGIMASEAVSLLRSFYEQGNPN 279 +VL K FKC GG+MASEAVSL RSFYEQGNPN Sbjct: 145 DVLGRKGFKCTGGVMASEAVSLFRSFYEQGNPN 177 >ref|XP_006453251.1| hypothetical protein CICLE_v10009594mg [Citrus clementina] gi|557556477|gb|ESR66491.1| hypothetical protein CICLE_v10009594mg [Citrus clementina] Length = 179 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 377 EVLEGKNFKCIGGIMASEAVSLLRSFYEQGNPN 279 +VL K FKC GG+MASEAVSL RSFYEQGNPN Sbjct: 145 DVLGRKGFKCTGGVMASEAVSLFRSFYEQGNPN 177 >ref|XP_007014421.1| Cytidine/deoxycytidylate deaminase family protein isoform 4, partial [Theobroma cacao] gi|508784784|gb|EOY32040.1| Cytidine/deoxycytidylate deaminase family protein isoform 4, partial [Theobroma cacao] Length = 211 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 377 EVLEGKNFKCIGGIMASEAVSLLRSFYEQGNPNA 276 EV + K FKC GG++ASEAVSL RSFYEQGNPNA Sbjct: 165 EVPQRKGFKCTGGLLASEAVSLFRSFYEQGNPNA 198 >ref|XP_007014418.1| Cytidine/deoxycytidylate deaminase family protein isoform 1 [Theobroma cacao] gi|508784781|gb|EOY32037.1| Cytidine/deoxycytidylate deaminase family protein isoform 1 [Theobroma cacao] Length = 202 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 377 EVLEGKNFKCIGGIMASEAVSLLRSFYEQGNPNA 276 EV + K FKC GG++ASEAVSL RSFYEQGNPNA Sbjct: 156 EVPQRKGFKCTGGLLASEAVSLFRSFYEQGNPNA 189 >ref|XP_007227178.1| hypothetical protein PRUPE_ppa020315mg [Prunus persica] gi|462424114|gb|EMJ28377.1| hypothetical protein PRUPE_ppa020315mg [Prunus persica] Length = 191 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 365 GKNFKCIGGIMASEAVSLLRSFYEQGNPNA 276 G+ FKC GGIMASEAVSL RSFYEQGNPNA Sbjct: 149 GEGFKCNGGIMASEAVSLFRSFYEQGNPNA 178 >ref|XP_006393469.1| hypothetical protein EUTSA_v10012316mg [Eutrema salsugineum] gi|557090047|gb|ESQ30755.1| hypothetical protein EUTSA_v10012316mg [Eutrema salsugineum] Length = 217 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 380 EEVLEGKNFKCIGGIMASEAVSLLRSFYEQGNPNA 276 EE GK +KC GGIMA EAVSL + FYEQGNPNA Sbjct: 170 EEAQRGKGYKCRGGIMAEEAVSLFKCFYEQGNPNA 204 >gb|EPS72078.1| hypothetical protein M569_02680, partial [Genlisea aurea] Length = 173 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 362 KNFKCIGGIMASEAVSLLRSFYEQGNPNA 276 K FKC GGI+ASEA++LLRSFYEQGNPNA Sbjct: 138 KGFKCTGGILASEAINLLRSFYEQGNPNA 166 >ref|XP_006305194.1| hypothetical protein CARUB_v10009558mg [Capsella rubella] gi|482573905|gb|EOA38092.1| hypothetical protein CARUB_v10009558mg [Capsella rubella] Length = 356 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 380 EEVLEGKNFKCIGGIMASEAVSLLRSFYEQGNPNA 276 EE GK +KC GGIMA EAVSL + FYEQGNPNA Sbjct: 309 EEAQRGKGYKCRGGIMAEEAVSLFKCFYEQGNPNA 343 >ref|NP_564523.3| tRNA adenosine deaminase 1 [Arabidopsis thaliana] gi|48310033|gb|AAT41740.1| At1g48175 [Arabidopsis thaliana] gi|50198832|gb|AAT70448.1| At1g48175 [Arabidopsis thaliana] gi|332194138|gb|AEE32259.1| Cytidine/deoxycytidylate deaminase family protein [Arabidopsis thaliana] Length = 182 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 380 EEVLEGKNFKCIGGIMASEAVSLLRSFYEQGNPNA 276 EE GK +KC GGIMA EAVSL + FYEQGNPNA Sbjct: 135 EEAQRGKGYKCRGGIMAEEAVSLFKCFYEQGNPNA 169