BLASTX nr result
ID: Akebia23_contig00016079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00016079 (234 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACH88048.1| beta-amyrin synthase [Nigella sativa] gi|19844349... 70 3e-10 ref|XP_007023608.1| Beta-Amyrin Synthase [Theobroma cacao] gi|50... 67 3e-09 ref|XP_002889222.1| hypothetical protein ARALYDRAFT_316793 [Arab... 67 3e-09 ref|XP_002513298.1| Cycloartenol synthase, putative [Ricinus com... 66 4e-09 dbj|BAE53429.1| beta-amyrin synthase [Lotus japonicus] 65 8e-09 ref|XP_003521102.1| PREDICTED: beta-amyrin synthase-like isoform... 65 8e-09 ref|XP_003521100.1| PREDICTED: beta-amyrin synthase-like isoform... 65 8e-09 sp|A8CDT3.1|LUPS_BRUGY RecName: Full=Lupeol synthase; Short=BgLU... 65 1e-08 sp|A8CDT2.1|BAS_BRUGY RecName: Full=Beta-amyrin synthase; Short=... 65 1e-08 sp|E2IUA6.1|TARS_KALDA RecName: Full=Taraxerol synthase; Short=K... 65 1e-08 ref|XP_002513299.1| Cycloartenol synthase, putative [Ricinus com... 65 1e-08 ref|XP_003627088.1| Beta-amyrin synthase [Medicago truncatula] g... 64 2e-08 ref|XP_006582958.1| PREDICTED: beta-amyrin synthase isoform X1 [... 64 2e-08 ref|XP_006300769.1| hypothetical protein CARUB_v10019844mg [Caps... 64 2e-08 ref|NP_001236591.1| beta-amyrin synthase [Glycine max] gi|234288... 64 2e-08 ref|XP_006389937.1| hypothetical protein EUTSA_v10018165mg [Eutr... 64 3e-08 ref|XP_004305792.1| PREDICTED: beta-amyrin synthase-like [Fragar... 64 3e-08 sp|Q9MB42.1|BAMS_GLYGL RecName: Full=Beta-amyrin synthase gi|673... 64 3e-08 ref|XP_002269395.1| PREDICTED: beta-amyrin synthase [Vitis vinif... 64 3e-08 sp|A8C980.1|GERS_RHISY RecName: Full=Germanicol synthase; Short=... 64 3e-08 >gb|ACH88048.1| beta-amyrin synthase [Nigella sativa] gi|198443498|gb|ACH88049.1| beta-amyrin synthase [Nigella sativa] Length = 761 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -3 Query: 127 MWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 MW LKIA +GP+S +L+STNN++GRQTWEFDPDAGTPEE Sbjct: 1 MWKLKIA--DATGPFSEYLYSTNNYIGRQTWEFDPDAGTPEE 40 >ref|XP_007023608.1| Beta-Amyrin Synthase [Theobroma cacao] gi|508778974|gb|EOY26230.1| Beta-Amyrin Synthase [Theobroma cacao] Length = 758 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -3 Query: 127 MWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 MW LKIA + V GPY L+STNN+VGRQTWEFDPDAGTPEE Sbjct: 1 MWKLKIA-EGVDGPY---LYSTNNYVGRQTWEFDPDAGTPEE 38 >ref|XP_002889222.1| hypothetical protein ARALYDRAFT_316793 [Arabidopsis lyrata subsp. lyrata] gi|297335063|gb|EFH65481.1| hypothetical protein ARALYDRAFT_316793 [Arabidopsis lyrata subsp. lyrata] Length = 1556 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/49 (65%), Positives = 36/49 (73%) Frame = -3 Query: 148 EEYYTSKMWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 EE + MW LKI + S PY LF+TNNFVGRQTWEFDPDAG+PEE Sbjct: 767 EELCSFVMWRLKIGEGSGDDPY---LFTTNNFVGRQTWEFDPDAGSPEE 812 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/42 (69%), Positives = 31/42 (73%) Frame = -3 Query: 127 MWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 MW LKIA + PY LFSTNNF+GRQTWEFDPDAG EE Sbjct: 1 MWKLKIANGNKEEPY---LFSTNNFLGRQTWEFDPDAGIAEE 39 >ref|XP_002513298.1| Cycloartenol synthase, putative [Ricinus communis] gi|223547206|gb|EEF48701.1| Cycloartenol synthase, putative [Ricinus communis] Length = 744 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -3 Query: 127 MWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 MW LKIA++ S PY L+STNN+VGRQ WEFDPDAGTPEE Sbjct: 1 MWRLKIAEEGSSDPY---LYSTNNYVGRQIWEFDPDAGTPEE 39 >dbj|BAE53429.1| beta-amyrin synthase [Lotus japonicus] Length = 762 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 127 MWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 MW LK+A G P++FSTNNFVGRQTWE+DPDAGTPEE Sbjct: 1 MWKLKVA----DGGKDPYIFSTNNFVGRQTWEYDPDAGTPEE 38 >ref|XP_003521102.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Glycine max] gi|571445298|ref|XP_006576766.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Glycine max] Length = 762 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -3 Query: 127 MWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 MW LKIA G P++FSTNNFVGRQTWEFDP+AGTPEE Sbjct: 1 MWRLKIA----DGGKDPYIFSTNNFVGRQTWEFDPEAGTPEE 38 >ref|XP_003521100.1| PREDICTED: beta-amyrin synthase-like isoformX1 [Glycine max] gi|571445294|ref|XP_006576765.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Glycine max] Length = 762 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -3 Query: 127 MWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 MW LKIA G P++FSTNNFVGRQTWEFDP+AGTPEE Sbjct: 1 MWRLKIA----DGGKDPYIFSTNNFVGRQTWEFDPEAGTPEE 38 >sp|A8CDT3.1|LUPS_BRUGY RecName: Full=Lupeol synthase; Short=BgLUS gi|157679393|dbj|BAF80444.1| lupeol synthase [Bruguiera gymnorhiza] Length = 761 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 127 MWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 MW LKIA+ G +P+++STNNFVGRQTWEFDP+AGTPEE Sbjct: 1 MWRLKIAE----GGNNPYIYSTNNFVGRQTWEFDPEAGTPEE 38 >sp|A8CDT2.1|BAS_BRUGY RecName: Full=Beta-amyrin synthase; Short=BgbAS gi|157679391|dbj|BAF80443.1| beta amyrin synthase [Bruguiera gymnorhiza] Length = 759 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -3 Query: 127 MWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 MW +KIA+ G P+L+STNN+VGRQTWEFDPDAGTPEE Sbjct: 1 MWRIKIAE----GGKDPYLYSTNNYVGRQTWEFDPDAGTPEE 38 >sp|E2IUA6.1|TARS_KALDA RecName: Full=Taraxerol synthase; Short=KdTAS gi|300807974|gb|ADK35123.1| taraxerol synthase [Kalanchoe daigremontiana] Length = 779 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = -3 Query: 145 EYYTSKMWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 E MW LKIA+ G P+L+STNN+VGRQTWEFDP+AGTPEE Sbjct: 14 EQRKGSMWKLKIAQ----GGKDPYLYSTNNYVGRQTWEFDPEAGTPEE 57 >ref|XP_002513299.1| Cycloartenol synthase, putative [Ricinus communis] gi|223547207|gb|EEF48702.1| Cycloartenol synthase, putative [Ricinus communis] Length = 757 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/42 (73%), Positives = 32/42 (76%) Frame = -3 Query: 127 MWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 MW LKI KD PY LFSTNNF GRQTWE+DPDAGTPEE Sbjct: 1 MWRLKI-KDGAGNPY---LFSTNNFAGRQTWEYDPDAGTPEE 38 >ref|XP_003627088.1| Beta-amyrin synthase [Medicago truncatula] gi|355521110|gb|AET01564.1| Beta-amyrin synthase [Medicago truncatula] Length = 472 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/44 (70%), Positives = 33/44 (75%) Frame = -3 Query: 133 SKMWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 S MW LKIA G P++FSTNNFVGRQTWEFD DAGTPEE Sbjct: 360 SIMWRLKIA----DGGKDPYIFSTNNFVGRQTWEFDADAGTPEE 399 >ref|XP_006582958.1| PREDICTED: beta-amyrin synthase isoform X1 [Glycine max] Length = 762 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 127 MWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 MW LKIA G P++FSTNNFVGRQTWEFDP+AG+PEE Sbjct: 1 MWRLKIA----DGGNDPYIFSTNNFVGRQTWEFDPEAGSPEE 38 >ref|XP_006300769.1| hypothetical protein CARUB_v10019844mg [Capsella rubella] gi|482569479|gb|EOA33667.1| hypothetical protein CARUB_v10019844mg [Capsella rubella] Length = 769 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = -3 Query: 127 MWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 MW LKIA + PY LFSTNNF+GRQTWEFDPDAGT EE Sbjct: 1 MWKLKIANGNKEDPY---LFSTNNFLGRQTWEFDPDAGTEEE 39 >ref|NP_001236591.1| beta-amyrin synthase [Glycine max] gi|23428800|gb|AAM23264.1| beta-amyrin synthase [Glycine max] Length = 739 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 127 MWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 MW LKIA G P++FSTNNFVGRQTWEFDP+AG+PEE Sbjct: 1 MWRLKIA----DGGNDPYIFSTNNFVGRQTWEFDPEAGSPEE 38 >ref|XP_006389937.1| hypothetical protein EUTSA_v10018165mg [Eutrema salsugineum] gi|557086371|gb|ESQ27223.1| hypothetical protein EUTSA_v10018165mg [Eutrema salsugineum] Length = 765 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = -3 Query: 127 MWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 MW LKIA + PY LFSTNNF+GRQTWEFDPDAGT EE Sbjct: 1 MWKLKIANGNKEEPY---LFSTNNFLGRQTWEFDPDAGTAEE 39 >ref|XP_004305792.1| PREDICTED: beta-amyrin synthase-like [Fragaria vesca subsp. vesca] Length = 764 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 127 MWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 MW LKIA+ SP+++STNNFVGRQTWEFDPDAGT EE Sbjct: 1 MWKLKIAEGGEDS--SPYIYSTNNFVGRQTWEFDPDAGTDEE 40 >sp|Q9MB42.1|BAMS_GLYGL RecName: Full=Beta-amyrin synthase gi|6730969|dbj|BAA89815.1| beta-amyrin synthase [Glycyrrhiza glabra] Length = 765 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -3 Query: 127 MWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 MW LKIA+ G P+++STNNFVGRQTWE+DPD GTPEE Sbjct: 1 MWRLKIAE----GGKDPYIYSTNNFVGRQTWEYDPDGGTPEE 38 >ref|XP_002269395.1| PREDICTED: beta-amyrin synthase [Vitis vinifera] gi|297740709|emb|CBI30891.3| unnamed protein product [Vitis vinifera] Length = 759 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -3 Query: 127 MWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 MW LKIA+ + PWL+S NNFVGRQ WEFDP+AGTPEE Sbjct: 1 MWKLKIAEG-----HGPWLYSLNNFVGRQIWEFDPEAGTPEE 37 >sp|A8C980.1|GERS_RHISY RecName: Full=Germanicol synthase; Short=RsM1 gi|157679387|dbj|BAF80441.1| multifunctional triterpene synthase [Rhizophora stylosa] Length = 759 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 127 MWNLKIAKDSVSGPYSPWLFSTNNFVGRQTWEFDPDAGTPEE 2 MW LKIA+ G P+L+STNN+VGRQ WEFDPDAGTPEE Sbjct: 1 MWRLKIAE----GGNDPYLYSTNNYVGRQIWEFDPDAGTPEE 38