BLASTX nr result
ID: Akebia23_contig00016043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00016043 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006493298.1| PREDICTED: cytochrome b-c1 complex subunit 6... 57 3e-06 ref|XP_007148445.1| hypothetical protein PHAVU_006G209400g [Phas... 56 4e-06 ref|XP_004485537.1| PREDICTED: cytochrome b-c1 complex subunit 6... 56 4e-06 ref|XP_004287060.1| PREDICTED: cytochrome b-c1 complex subunit 6... 56 6e-06 ref|XP_007221592.1| hypothetical protein PRUPE_ppa017907mg [Prun... 56 6e-06 >ref|XP_006493298.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X1 [Citrus sinensis] Length = 87 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 166 PSLSMADEEPVDQKKYYEDSCKPKCVKPLL 255 PS +MADEE VDQKKY+E++CKPKCVKPLL Sbjct: 15 PSFAMADEELVDQKKYFEEACKPKCVKPLL 44 >ref|XP_007148445.1| hypothetical protein PHAVU_006G209400g [Phaseolus vulgaris] gi|561021668|gb|ESW20439.1| hypothetical protein PHAVU_006G209400g [Phaseolus vulgaris] Length = 69 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 178 MADEEPVDQKKYYEDSCKPKCVKPLL 255 MADEEPVDQK+Y EDSCKPKCVKPLL Sbjct: 1 MADEEPVDQKRYLEDSCKPKCVKPLL 26 >ref|XP_004485537.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Cicer arietinum] Length = 69 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 178 MADEEPVDQKKYYEDSCKPKCVKPLL 255 MADEEPVDQK+Y EDSCKPKCVKPLL Sbjct: 1 MADEEPVDQKRYLEDSCKPKCVKPLL 26 >ref|XP_004287060.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Fragaria vesca subsp. vesca] Length = 69 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +1 Query: 178 MADEEPVDQKKYYEDSCKPKCVKPLL 255 MADEEPVDQKKY EDSCKPKCVKP L Sbjct: 1 MADEEPVDQKKYLEDSCKPKCVKPFL 26 >ref|XP_007221592.1| hypothetical protein PRUPE_ppa017907mg [Prunus persica] gi|462418528|gb|EMJ22791.1| hypothetical protein PRUPE_ppa017907mg [Prunus persica] Length = 121 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 178 MADEEPVDQKKYYEDSCKPKCVKPLL 255 MADEEPVDQKKY E+SCKPKCVKPLL Sbjct: 53 MADEEPVDQKKYLEESCKPKCVKPLL 78