BLASTX nr result
ID: Akebia23_contig00015939
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00015939 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPE08609.1| 60s ribosomal protein l16 [Ophiostoma piceae UAMH... 83 3e-14 gb|EFX00180.1| 60S ribosomal protein l16 [Grosmannia clavigera k... 83 3e-14 gb|ERT00595.1| 60S ribosomal protein L16 [Sporothrix schenckii A... 82 6e-14 ref|XP_003000559.1| 60S ribosomal protein L16 [Verticillium alfa... 82 6e-14 gb|ETS79709.1| 60S ribosomal protein L16 [Pestalotiopsis fici W1... 82 8e-14 ref|XP_007279305.1| 60s ribosomal protein l16 [Colletotrichum gl... 82 8e-14 gb|EFQ25839.1| ribosomal protein L13 [Colletotrichum graminicola... 82 8e-14 ref|XP_007594433.1| ribosomal protein L13 [Colletotrichum fiorin... 81 1e-13 emb|CCF47368.1| 60S ribosomal protein L16, partial [Colletotrich... 81 1e-13 gb|ENH85897.1| 60s ribosomal protein l16 [Colletotrichum orbicul... 81 2e-13 ref|XP_001911222.1| hypothetical protein [Podospora anserina S m... 81 2e-13 gb|EON98747.1| putative 60s ribosomal protein l16 protein [Togni... 80 2e-13 gb|EJT76620.1| 60S ribosomal protein L16 [Gaeumannomyces gramini... 80 4e-13 ref|XP_001225089.1| 60S ribosomal protein L16 [Chaetomium globos... 79 5e-13 gb|EPE35086.1| Ribosomal protein L13 [Glarea lozoyensis ATCC 20868] 79 5e-13 gb|EHK96506.1| putative 60S ribosomal protein L16 [Glarea lozoye... 79 5e-13 ref|XP_003661900.1| hypothetical protein MYCTH_2314728 [Myceliop... 78 1e-12 ref|XP_003649454.1| 60S ribosomal protein L16 [Thielavia terrest... 78 1e-12 ref|XP_001591799.1| 60S ribosomal protein L16 [Sclerotinia scler... 78 1e-12 gb|EMR80997.1| putative 60s ribosomal protein l16 protein [Botry... 77 2e-12 >gb|EPE08609.1| 60s ribosomal protein l16 [Ophiostoma piceae UAMH 11346] Length = 225 Score = 83.2 bits (204), Expect = 3e-14 Identities = 39/54 (72%), Positives = 44/54 (81%) Frame = -1 Query: 343 WKYQDVVARLEERRKAKSAAYYERKKKTRQQIGQASKNAKHDSKTTKTLEGYGY 182 WKYQDVVARLEERRKAK AAYYERKK +Q+ +A KNAK D+KT K LE +GY Sbjct: 172 WKYQDVVARLEERRKAKGAAYYERKKVAARQLTEAKKNAKVDTKTAKALESFGY 225 >gb|EFX00180.1| 60S ribosomal protein l16 [Grosmannia clavigera kw1407] Length = 202 Score = 83.2 bits (204), Expect = 3e-14 Identities = 39/54 (72%), Positives = 43/54 (79%) Frame = -1 Query: 343 WKYQDVVARLEERRKAKSAAYYERKKKTRQQIGQASKNAKHDSKTTKTLEGYGY 182 WKYQDVVARLEERRKAK AAYYERKK +Q+ +A KNAK D KT K LE +GY Sbjct: 149 WKYQDVVARLEERRKAKGAAYYERKKVAARQLSEAKKNAKVDPKTAKALEAFGY 202 >gb|ERT00595.1| 60S ribosomal protein L16 [Sporothrix schenckii ATCC 58251] Length = 202 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/54 (72%), Positives = 43/54 (79%) Frame = -1 Query: 343 WKYQDVVARLEERRKAKSAAYYERKKKTRQQIGQASKNAKHDSKTTKTLEGYGY 182 WKYQDVVARLEERRKAK AAYYERKK +Q+ +A KNAK D KT K LE +GY Sbjct: 149 WKYQDVVARLEERRKAKGAAYYERKKVAARQLTEAKKNAKVDPKTAKALEAFGY 202 >ref|XP_003000559.1| 60S ribosomal protein L16 [Verticillium alfalfae VaMs.102] gi|261360516|gb|EEY22944.1| 60S ribosomal protein L16 [Verticillium alfalfae VaMs.102] gi|346972588|gb|EGY16040.1| 60S ribosomal protein L16 [Verticillium dahliae VdLs.17] Length = 202 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/54 (70%), Positives = 44/54 (81%) Frame = -1 Query: 343 WKYQDVVARLEERRKAKSAAYYERKKKTRQQIGQASKNAKHDSKTTKTLEGYGY 182 WKYQDVVARLEERRKAK AAYYERKK ++Q+ + K+AK D KTTK LE +GY Sbjct: 149 WKYQDVVARLEERRKAKGAAYYERKKVAQRQLADSKKSAKVDDKTTKALEAFGY 202 >gb|ETS79709.1| 60S ribosomal protein L16 [Pestalotiopsis fici W106-1] Length = 202 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/54 (70%), Positives = 44/54 (81%) Frame = -1 Query: 343 WKYQDVVARLEERRKAKSAAYYERKKKTRQQIGQASKNAKHDSKTTKTLEGYGY 182 WKYQDVV RLEERRKAK AAYYERKK ++Q+ A KNAK DSKT++ L G+GY Sbjct: 149 WKYQDVVERLEERRKAKGAAYYERKKLAQRQLSDAKKNAKVDSKTSEALAGFGY 202 >ref|XP_007279305.1| 60s ribosomal protein l16 [Colletotrichum gloeosporioides Nara gc5] gi|429856676|gb|ELA31573.1| 60s ribosomal protein l16 [Colletotrichum gloeosporioides Nara gc5] gi|530479523|gb|EQB58698.1| hypothetical protein CGLO_01028 [Colletotrichum gloeosporioides Cg-14] Length = 202 Score = 82.0 bits (201), Expect = 8e-14 Identities = 39/54 (72%), Positives = 43/54 (79%) Frame = -1 Query: 343 WKYQDVVARLEERRKAKSAAYYERKKKTRQQIGQASKNAKHDSKTTKTLEGYGY 182 WKYQDVVARLEERRKAK AAYYERKK ++QI A KNAK D KT + LE +GY Sbjct: 149 WKYQDVVARLEERRKAKGAAYYERKKVAQRQITDAKKNAKVDQKTAQALEAFGY 202 >gb|EFQ25839.1| ribosomal protein L13 [Colletotrichum graminicola M1.001] Length = 202 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/54 (70%), Positives = 43/54 (79%) Frame = -1 Query: 343 WKYQDVVARLEERRKAKSAAYYERKKKTRQQIGQASKNAKHDSKTTKTLEGYGY 182 WKYQDVVARLEERRKAK AAYYERKK ++Q+ A KNAK D KT + LE +GY Sbjct: 149 WKYQDVVARLEERRKAKGAAYYERKKVAQRQLSDAKKNAKVDEKTAQALEAFGY 202 >ref|XP_007594433.1| ribosomal protein L13 [Colletotrichum fioriniae PJ7] gi|588901464|gb|EXF81930.1| ribosomal protein L13 [Colletotrichum fioriniae PJ7] Length = 202 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/54 (70%), Positives = 43/54 (79%) Frame = -1 Query: 343 WKYQDVVARLEERRKAKSAAYYERKKKTRQQIGQASKNAKHDSKTTKTLEGYGY 182 WKYQDVVARLEERRKAK AAYYERKK ++Q+ A KNAK D KT + LE +GY Sbjct: 149 WKYQDVVARLEERRKAKGAAYYERKKVAQRQLTDAKKNAKVDQKTAQALEAFGY 202 >emb|CCF47368.1| 60S ribosomal protein L16, partial [Colletotrichum higginsianum] Length = 195 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/54 (70%), Positives = 43/54 (79%) Frame = -1 Query: 343 WKYQDVVARLEERRKAKSAAYYERKKKTRQQIGQASKNAKHDSKTTKTLEGYGY 182 WKYQDVVARLEERRKAK AAYYERKK ++Q+ A KNAK D KT + LE +GY Sbjct: 142 WKYQDVVARLEERRKAKGAAYYERKKVAQRQLTDAKKNAKVDQKTAQALEAFGY 195 >gb|ENH85897.1| 60s ribosomal protein l16 [Colletotrichum orbiculare MAFF 240422] Length = 213 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/54 (70%), Positives = 43/54 (79%) Frame = -1 Query: 343 WKYQDVVARLEERRKAKSAAYYERKKKTRQQIGQASKNAKHDSKTTKTLEGYGY 182 WKYQDVVARLEERRKAK AAYYERKK ++Q+ A KNAK D KT + LE YG+ Sbjct: 160 WKYQDVVARLEERRKAKGAAYYERKKVAQRQLTDAKKNAKVDQKTAQALEAYGH 213 >ref|XP_001911222.1| hypothetical protein [Podospora anserina S mat+] gi|170946246|emb|CAP73047.1| unnamed protein product [Podospora anserina S mat+] Length = 202 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/54 (70%), Positives = 43/54 (79%) Frame = -1 Query: 343 WKYQDVVARLEERRKAKSAAYYERKKKTRQQIGQASKNAKHDSKTTKTLEGYGY 182 WKYQDVVARLEERRKAK AAYYERKK +Q+ +A K AK DSKTT+ L +GY Sbjct: 149 WKYQDVVARLEERRKAKGAAYYERKKLAARQLSEAKKTAKVDSKTTEALAAFGY 202 >gb|EON98747.1| putative 60s ribosomal protein l16 protein [Togninia minima UCRPA7] Length = 202 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/54 (68%), Positives = 41/54 (75%) Frame = -1 Query: 343 WKYQDVVARLEERRKAKSAAYYERKKKTRQQIGQASKNAKHDSKTTKTLEGYGY 182 WKYQDVV RLEERRKAK AAYYERKK ++Q+ +A KN K D KT LE YGY Sbjct: 149 WKYQDVVERLEERRKAKGAAYYERKKLAQRQLSEAKKNTKVDKKTASALESYGY 202 >gb|EJT76620.1| 60S ribosomal protein L16 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 202 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/54 (66%), Positives = 43/54 (79%) Frame = -1 Query: 343 WKYQDVVARLEERRKAKSAAYYERKKKTRQQIGQASKNAKHDSKTTKTLEGYGY 182 WKYQDVVARLEERRKAK AAYYERKK ++Q+ ++ KNA D KT + L+ YGY Sbjct: 149 WKYQDVVARLEERRKAKGAAYYERKKLAQRQVSESKKNATVDEKTAEALKAYGY 202 >ref|XP_001225089.1| 60S ribosomal protein L16 [Chaetomium globosum CBS 148.51] gi|88178712|gb|EAQ86180.1| 60S ribosomal protein L16 [Chaetomium globosum CBS 148.51] Length = 202 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/54 (66%), Positives = 44/54 (81%) Frame = -1 Query: 343 WKYQDVVARLEERRKAKSAAYYERKKKTRQQIGQASKNAKHDSKTTKTLEGYGY 182 WKYQDVVARLEERRKAK AAYYERKK +Q+ +A K AK D+KT++ L+ +GY Sbjct: 149 WKYQDVVARLEERRKAKGAAYYERKKLAARQLSEAKKTAKVDTKTSEALQAFGY 202 >gb|EPE35086.1| Ribosomal protein L13 [Glarea lozoyensis ATCC 20868] Length = 202 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/54 (68%), Positives = 42/54 (77%) Frame = -1 Query: 343 WKYQDVVARLEERRKAKSAAYYERKKKTRQQIGQASKNAKHDSKTTKTLEGYGY 182 WKYQDVVARLEERRK K AAYY RKK R+Q+ A+K+AK D KT + L GYGY Sbjct: 149 WKYQDVVARLEERRKVKGAAYYARKKAARRQLSDATKSAKVDEKTKEQLAGYGY 202 >gb|EHK96506.1| putative 60S ribosomal protein L16 [Glarea lozoyensis 74030] Length = 114 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/54 (68%), Positives = 42/54 (77%) Frame = -1 Query: 343 WKYQDVVARLEERRKAKSAAYYERKKKTRQQIGQASKNAKHDSKTTKTLEGYGY 182 WKYQDVVARLEERRK K AAYY RKK R+Q+ A+K+AK D KT + L GYGY Sbjct: 61 WKYQDVVARLEERRKVKGAAYYARKKAARRQLSDATKSAKVDEKTKEQLAGYGY 114 >ref|XP_003661900.1| hypothetical protein MYCTH_2314728 [Myceliophthora thermophila ATCC 42464] gi|347009168|gb|AEO56655.1| hypothetical protein MYCTH_2314728 [Myceliophthora thermophila ATCC 42464] Length = 202 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/54 (66%), Positives = 41/54 (75%) Frame = -1 Query: 343 WKYQDVVARLEERRKAKSAAYYERKKKTRQQIGQASKNAKHDSKTTKTLEGYGY 182 WKYQDVV RLEERRKAK AAYYERKK +Q+ +A K AK D KT + L+ YGY Sbjct: 149 WKYQDVVERLEERRKAKGAAYYERKKLAARQLSEAKKTAKVDPKTAEALQAYGY 202 >ref|XP_003649454.1| 60S ribosomal protein L16 [Thielavia terrestris NRRL 8126] gi|346996715|gb|AEO63118.1| hypothetical protein THITE_70134 [Thielavia terrestris NRRL 8126] Length = 202 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/54 (68%), Positives = 41/54 (75%) Frame = -1 Query: 343 WKYQDVVARLEERRKAKSAAYYERKKKTRQQIGQASKNAKHDSKTTKTLEGYGY 182 WKYQDVV RLEERRKAK AAYYERKK +Q+ +A K AK DSKT + L YGY Sbjct: 149 WKYQDVVERLEERRKAKGAAYYERKKLAARQLSEAKKAAKVDSKTAEALAAYGY 202 >ref|XP_001591799.1| 60S ribosomal protein L16 [Sclerotinia sclerotiorum 1980 UF-70] gi|154705023|gb|EDO04762.1| 60S ribosomal protein L16 [Sclerotinia sclerotiorum 1980 UF-70] Length = 202 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/54 (68%), Positives = 41/54 (75%) Frame = -1 Query: 343 WKYQDVVARLEERRKAKSAAYYERKKKTRQQIGQASKNAKHDSKTTKTLEGYGY 182 WKYQDVVARLEERRK KSAAYYERKK R+Q+ +A K+AK D KT L GY Sbjct: 149 WKYQDVVARLEERRKVKSAAYYERKKAARKQLSEAQKSAKIDDKTKSELAALGY 202 >gb|EMR80997.1| putative 60s ribosomal protein l16 protein [Botryotinia fuckeliana BcDW1] Length = 184 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/54 (68%), Positives = 41/54 (75%) Frame = -1 Query: 343 WKYQDVVARLEERRKAKSAAYYERKKKTRQQIGQASKNAKHDSKTTKTLEGYGY 182 WKYQDVVARLEERRK KSAAYYERKK R+Q+ +A K+AK D KT L GY Sbjct: 131 WKYQDVVARLEERRKVKSAAYYERKKAARKQLSEAQKSAKIDDKTKTELAALGY 184