BLASTX nr result
ID: Akebia23_contig00015789
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00015789 (1658 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007516862.1| hypothetical protein GlmaxMp13 (mitochondrio... 66 5e-08 >ref|YP_007516862.1| hypothetical protein GlmaxMp13 (mitochondrion) [Glycine max] gi|403311591|gb|AFR34339.1| hypothetical protein GlmaxMp13 (mitochondrion) [Glycine max] Length = 287 Score = 65.9 bits (159), Expect = 5e-08 Identities = 39/63 (61%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = -1 Query: 872 VPKCFLWISNKGKFRPCYVI*LIQVLYCSPLPE--DRFELSFQDLQYD*FPLCYLAKLVL 699 VP C LWISNKGK Y+ LI+V CSPLPE D E SFQDLQ D FPLCY AK Sbjct: 140 VPGCCLWISNKGKPPLFYLCHLIKVPCCSPLPEAKDGVEPSFQDLQSDTFPLCYPAKPAT 199 Query: 698 SRA 690 S A Sbjct: 200 SCA 202