BLASTX nr result
ID: Akebia23_contig00015682
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00015682 (401 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] 80 2e-22 ref|XP_002534720.1| conserved hypothetical protein [Ricinus comm... 100 3e-19 ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|... 69 7e-10 >emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] Length = 138 Score = 79.7 bits (195), Expect(2) = 2e-22 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +1 Query: 52 GGGITPFSKEPYVTLSRHTAPSRNQDLPFPLTNGSSN 162 GGGITPFSKEPYVTLSRHTAPSRN+DLPFPLTNGSSN Sbjct: 20 GGGITPFSKEPYVTLSRHTAPSRNKDLPFPLTNGSSN 56 Score = 52.0 bits (123), Expect(2) = 2e-22 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 209 VALACFQVQALAVEASRQKLTSGPGR 286 VA+ACFQVQALAVEASRQKLTSGPGR Sbjct: 66 VAVACFQVQALAVEASRQKLTSGPGR 91 >ref|XP_002534720.1| conserved hypothetical protein [Ricinus communis] gi|223524693|gb|EEF27662.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 100 bits (248), Expect = 3e-19 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 1/50 (2%) Frame = +3 Query: 18 MQLRGPLIGPDRWWYHTLLKGTVRDTLASYGSVPESG-PPLSFDQRVLEP 164 MQLRGPL+GPDRWWYHTLLKGTVRDTLASYGS PESG PP SFDQRVLEP Sbjct: 1 MQLRGPLVGPDRWWYHTLLKGTVRDTLASYGSAPESGPPPFSFDQRVLEP 50 >ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|gb|AES58602.1| Maturase [Medicago truncatula] Length = 996 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 101 RESVTYGSFEKGVIPPPIRPDERSTELHPYSPG 3 RE++TYGSFEKGV PPPIRPDERSTELHPYSPG Sbjct: 880 RENLTYGSFEKGVRPPPIRPDERSTELHPYSPG 912