BLASTX nr result
ID: Akebia23_contig00014627
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00014627 (1541 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN82968.1| hypothetical protein VITISV_021857 [Vitis vinifera] 37 1e-06 >emb|CAN82968.1| hypothetical protein VITISV_021857 [Vitis vinifera] Length = 1122 Score = 37.0 bits (84), Expect(3) = 1e-06 Identities = 16/25 (64%), Positives = 21/25 (84%) Frame = -1 Query: 956 ALFSIHVNGSDAGFFRSSPGLRQGE 882 A FS+ +NGS AGFF+S+ GLRQG+ Sbjct: 528 ASFSVLINGSPAGFFQSTRGLRQGD 552 Score = 33.5 bits (75), Expect(3) = 1e-06 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = -3 Query: 870 FMVMVEALGRPISKLLEGGILEGFRMR---NNDVSVTHFHIADVSVV 739 F++ +EAL I+K + GG L G R+R N++ V+H AD ++V Sbjct: 559 FVLGMEALSCLINKAVRGGFLSGCRLRGRGGNEIQVSHLLFADDTLV 605 Score = 29.3 bits (64), Expect(3) = 1e-06 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -2 Query: 1021 MEKGYDHVNWNFL 983 +EK YDH+NW+FL Sbjct: 492 LEKAYDHINWDFL 504