BLASTX nr result
ID: Akebia23_contig00014603
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00014603 (805 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006369889.1| hypothetical protein POPTR_0001s34480g [Popu... 58 5e-06 ref|XP_004310070.1| PREDICTED: probable glycosyltransferase At3g... 57 8e-06 >ref|XP_006369889.1| hypothetical protein POPTR_0001s34480g [Populus trichocarpa] gi|550348858|gb|ERP66458.1| hypothetical protein POPTR_0001s34480g [Populus trichocarpa] Length = 188 Score = 57.8 bits (138), Expect = 5e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 604 MQVLRWNLVKEGGTLKLNQSWRVKNFTKGLELFQ 503 ++V WNLV E GTLKLN+SW+VK+FTKGLELFQ Sbjct: 94 LKVAGWNLVNENGTLKLNRSWKVKSFTKGLELFQ 127 >ref|XP_004310070.1| PREDICTED: probable glycosyltransferase At3g07620-like [Fragaria vesca subsp. vesca] Length = 446 Score = 57.0 bits (136), Expect = 8e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -2 Query: 456 HQTYEGIVRAKIAKILVGYEDVHYEQSFATGESIKSVT 343 H+ EGIVRAK+AK+L GY+DVHYE+S ATGE+IK T Sbjct: 270 HRKDEGIVRAKLAKVLAGYDDVHYERSVATGENIKLST 307