BLASTX nr result
ID: Akebia23_contig00014223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00014223 (675 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA40387.1| TPA: hypothetical protein ZEAMMB73_782196, parti... 58 3e-06 >tpg|DAA40387.1| TPA: hypothetical protein ZEAMMB73_782196, partial [Zea mays] Length = 155 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/46 (52%), Positives = 33/46 (71%) Frame = -3 Query: 523 PSMTSNIYNIYRFLEGDFDTYVTQMRHPHVWGGESELLILLKIFSL 386 PS ++ + RF+EGDFDTYV+Q+R PHVWGGE ELL+ + + Sbjct: 55 PSPATSTHQATRFVEGDFDTYVSQIRKPHVWGGEPELLMASHVLQM 100