BLASTX nr result
ID: Akebia23_contig00014214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00014214 (453 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533956.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 ref|XP_006426258.1| hypothetical protein CICLE_v10026840mg [Citr... 56 4e-06 >ref|XP_002533956.1| conserved hypothetical protein [Ricinus communis] gi|223526069|gb|EEF28425.1| conserved hypothetical protein [Ricinus communis] Length = 100 Score = 58.2 bits (139), Expect = 1e-06 Identities = 39/98 (39%), Positives = 45/98 (45%), Gaps = 6/98 (6%) Frame = +2 Query: 107 MCFDQQRSISIADLISSRARSANND------AVVXXXXXXXXXXXXXXXXXXXXXXXXXX 268 MC+ +RS+S DLI SR R ND +VV Sbjct: 1 MCYGHRRSLSPDDLIPSRNRRPQNDNENNNASVVEDLRDRLAETEARLERARAREAELSR 60 Query: 269 XXXXMKRFLSVMEILETYLKSRYRELQAQILNRISSLP 382 MKRF+SVMEILETYLK RYRE Q + SSLP Sbjct: 61 RLEEMKRFVSVMEILETYLKRRYREQQEHVARFFSSLP 98 >ref|XP_006426258.1| hypothetical protein CICLE_v10026840mg [Citrus clementina] gi|567867273|ref|XP_006426259.1| hypothetical protein CICLE_v10026840mg [Citrus clementina] gi|568823852|ref|XP_006466322.1| PREDICTED: protein SKIP34-like [Citrus sinensis] gi|557528248|gb|ESR39498.1| hypothetical protein CICLE_v10026840mg [Citrus clementina] gi|557528249|gb|ESR39499.1| hypothetical protein CICLE_v10026840mg [Citrus clementina] Length = 96 Score = 56.2 bits (134), Expect = 4e-06 Identities = 35/96 (36%), Positives = 46/96 (47%), Gaps = 2/96 (2%) Frame = +2 Query: 107 MCFDQQRSISIADLISSRARSANND--AVVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 280 MC+ +RS+S SRAR N+ VV Sbjct: 1 MCYGHRRSVSPDSFAQSRARRTENENVLVVEDLRGRLAETEARLARARAREAELSRRLEE 60 Query: 281 MKRFLSVMEILETYLKSRYRELQAQILNRISSLPKK 388 MKRF+SVMEILETYLK R+RE Q +++ SS+P+K Sbjct: 61 MKRFVSVMEILETYLKRRFREQQEHLVHLFSSIPQK 96