BLASTX nr result
ID: Akebia23_contig00013466
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00013466 (871 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006412272.1| hypothetical protein EUTSA_v10027054mg [Eutr... 63 2e-07 ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containi... 63 2e-07 gb|EMT15321.1| hypothetical protein F775_05476 [Aegilops tauschii] 62 2e-07 gb|EYU28659.1| hypothetical protein MIMGU_mgv1a022202mg, partial... 62 3e-07 ref|XP_007212650.1| hypothetical protein PRUPE_ppa018206mg, part... 62 3e-07 ref|XP_002970228.1| hypothetical protein SELMODRAFT_93321 [Selag... 62 3e-07 ref|XP_002978388.1| hypothetical protein SELMODRAFT_108652 [Sela... 62 3e-07 ref|XP_006413827.1| hypothetical protein EUTSA_v10027143mg [Eutr... 62 4e-07 ref|XP_004965051.1| PREDICTED: pentatricopeptide repeat-containi... 62 4e-07 ref|XP_004247664.1| PREDICTED: pentatricopeptide repeat-containi... 62 4e-07 ref|XP_004158687.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 62 4e-07 ref|XP_004134903.1| PREDICTED: pentatricopeptide repeat-containi... 62 4e-07 ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [S... 62 4e-07 gb|EXB93905.1| hypothetical protein L484_002061 [Morus notabilis] 61 5e-07 ref|XP_007035985.1| Tetratricopeptide repeat-like superfamily pr... 61 5e-07 ref|XP_004295338.1| PREDICTED: pentatricopeptide repeat-containi... 61 5e-07 ref|XP_004155856.1| PREDICTED: pentatricopeptide repeat-containi... 61 5e-07 ref|XP_004134356.1| PREDICTED: pentatricopeptide repeat-containi... 61 5e-07 ref|XP_003564043.1| PREDICTED: pentatricopeptide repeat-containi... 61 5e-07 gb|EEE55297.1| hypothetical protein OsJ_03249 [Oryza sativa Japo... 61 5e-07 >ref|XP_006412272.1| hypothetical protein EUTSA_v10027054mg [Eutrema salsugineum] gi|557113442|gb|ESQ53725.1| hypothetical protein EUTSA_v10027054mg [Eutrema salsugineum] Length = 638 Score = 62.8 bits (151), Expect = 2e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 2 SKVTQREIVIRDRNRFHHFRDGSCSCEDYW 91 SKV +REI++RD NRFHHFRDGSCSC DYW Sbjct: 609 SKVVEREIIVRDTNRFHHFRDGSCSCRDYW 638 >ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Setaria italica] Length = 695 Score = 62.8 bits (151), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 2 SKVTQREIVIRDRNRFHHFRDGSCSCEDYW 91 SKV REIV+RDRNRFHHF+DGSCSC DYW Sbjct: 666 SKVYNREIVVRDRNRFHHFKDGSCSCNDYW 695 >gb|EMT15321.1| hypothetical protein F775_05476 [Aegilops tauschii] Length = 542 Score = 62.4 bits (150), Expect = 2e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 2 SKVTQREIVIRDRNRFHHFRDGSCSCEDYW 91 S+V +REIV+RDRNRFHHFRDG+CSC DYW Sbjct: 404 SRVFEREIVVRDRNRFHHFRDGACSCNDYW 433 >gb|EYU28659.1| hypothetical protein MIMGU_mgv1a022202mg, partial [Mimulus guttatus] Length = 682 Score = 62.0 bits (149), Expect = 3e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 2 SKVTQREIVIRDRNRFHHFRDGSCSCEDYW 91 SKVT+REIV+RD NRFHHFRDG CSC DYW Sbjct: 653 SKVTEREIVVRDSNRFHHFRDGICSCGDYW 682 >ref|XP_007212650.1| hypothetical protein PRUPE_ppa018206mg, partial [Prunus persica] gi|462408515|gb|EMJ13849.1| hypothetical protein PRUPE_ppa018206mg, partial [Prunus persica] Length = 604 Score = 62.0 bits (149), Expect = 3e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 2 SKVTQREIVIRDRNRFHHFRDGSCSCEDYW 91 SKV REIV+RDR+RFHHFRDGSCSC DYW Sbjct: 575 SKVYDREIVVRDRSRFHHFRDGSCSCRDYW 604 >ref|XP_002970228.1| hypothetical protein SELMODRAFT_93321 [Selaginella moellendorffii] gi|300161744|gb|EFJ28358.1| hypothetical protein SELMODRAFT_93321 [Selaginella moellendorffii] Length = 936 Score = 62.0 bits (149), Expect = 3e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 2 SKVTQREIVIRDRNRFHHFRDGSCSCEDYW 91 SK+T REIV+RD +RFHHFRDGSCSC+DYW Sbjct: 907 SKITGREIVVRDNHRFHHFRDGSCSCKDYW 936 >ref|XP_002978388.1| hypothetical protein SELMODRAFT_108652 [Selaginella moellendorffii] gi|300153737|gb|EFJ20374.1| hypothetical protein SELMODRAFT_108652 [Selaginella moellendorffii] Length = 687 Score = 62.0 bits (149), Expect = 3e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 2 SKVTQREIVIRDRNRFHHFRDGSCSCEDYW 91 SK+T REIV+RD +RFHHFRDGSCSC+DYW Sbjct: 658 SKITGREIVVRDNHRFHHFRDGSCSCKDYW 687 >ref|XP_006413827.1| hypothetical protein EUTSA_v10027143mg [Eutrema salsugineum] gi|557114997|gb|ESQ55280.1| hypothetical protein EUTSA_v10027143mg [Eutrema salsugineum] Length = 595 Score = 61.6 bits (148), Expect = 4e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 2 SKVTQREIVIRDRNRFHHFRDGSCSCEDYW 91 SKV REIV+RDR+RFHHF+DGSCSC+DYW Sbjct: 566 SKVYNREIVVRDRSRFHHFKDGSCSCQDYW 595 >ref|XP_004965051.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Setaria italica] Length = 601 Score = 61.6 bits (148), Expect = 4e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 2 SKVTQREIVIRDRNRFHHFRDGSCSCEDYW 91 S+V REIV+RDRNRFHHFRDG CSC+DYW Sbjct: 572 SRVFDREIVVRDRNRFHHFRDGKCSCKDYW 601 >ref|XP_004247664.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820-like [Solanum lycopersicum] Length = 722 Score = 61.6 bits (148), Expect = 4e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 2 SKVTQREIVIRDRNRFHHFRDGSCSCEDYW 91 SKV +REIV+RDR RFHH+RDGSCSC+DYW Sbjct: 693 SKVFEREIVVRDRTRFHHYRDGSCSCKDYW 722 >ref|XP_004158687.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis sativus] Length = 609 Score = 61.6 bits (148), Expect = 4e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +2 Query: 2 SKVTQREIVIRDRNRFHHFRDGSCSCEDYW 91 SKV +REI++RDR+RFHHF+DGSCSC+DYW Sbjct: 580 SKVFEREIIVRDRSRFHHFKDGSCSCKDYW 609 >ref|XP_004134903.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis sativus] Length = 609 Score = 61.6 bits (148), Expect = 4e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +2 Query: 2 SKVTQREIVIRDRNRFHHFRDGSCSCEDYW 91 SKV +REI++RDR+RFHHF+DGSCSC+DYW Sbjct: 580 SKVFEREIIVRDRSRFHHFKDGSCSCKDYW 609 >ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] gi|241939236|gb|EES12381.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] Length = 693 Score = 61.6 bits (148), Expect = 4e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 2 SKVTQREIVIRDRNRFHHFRDGSCSCEDYW 91 SKV REIV+RDRNRFHHF+DG+CSC DYW Sbjct: 664 SKVYNREIVVRDRNRFHHFKDGTCSCNDYW 693 >gb|EXB93905.1| hypothetical protein L484_002061 [Morus notabilis] Length = 705 Score = 61.2 bits (147), Expect = 5e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 2 SKVTQREIVIRDRNRFHHFRDGSCSCEDYW 91 SKV +REIV+RDRNRFHHF++GSCSC DYW Sbjct: 676 SKVFKREIVLRDRNRFHHFKEGSCSCNDYW 705 >ref|XP_007035985.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] gi|508715014|gb|EOY06911.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 628 Score = 61.2 bits (147), Expect = 5e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 2 SKVTQREIVIRDRNRFHHFRDGSCSCEDYW 91 SKV REI++RDRNRFHHF+DG CSC+DYW Sbjct: 599 SKVFDREIIVRDRNRFHHFKDGECSCKDYW 628 >ref|XP_004295338.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 650 Score = 61.2 bits (147), Expect = 5e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 2 SKVTQREIVIRDRNRFHHFRDGSCSCEDYW 91 SKV +REI++RD NRFHHFRDGSCSC DYW Sbjct: 621 SKVERREIIVRDTNRFHHFRDGSCSCGDYW 650 >ref|XP_004155856.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Cucumis sativus] Length = 654 Score = 61.2 bits (147), Expect = 5e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 2 SKVTQREIVIRDRNRFHHFRDGSCSCEDYW 91 SK+ QR+I +RDRNRFHHF+DGSCSC DYW Sbjct: 625 SKIYQRQITLRDRNRFHHFKDGSCSCRDYW 654 >ref|XP_004134356.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Cucumis sativus] Length = 654 Score = 61.2 bits (147), Expect = 5e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 2 SKVTQREIVIRDRNRFHHFRDGSCSCEDYW 91 SK+ QR+I +RDRNRFHHF+DGSCSC DYW Sbjct: 625 SKIYQRQITLRDRNRFHHFKDGSCSCRDYW 654 >ref|XP_003564043.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Brachypodium distachyon] Length = 599 Score = 61.2 bits (147), Expect = 5e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +2 Query: 2 SKVTQREIVIRDRNRFHHFRDGSCSCEDYW 91 S+V +REIV+RDRNRFHHF+DG+CSC DYW Sbjct: 570 SRVFEREIVVRDRNRFHHFKDGTCSCRDYW 599 >gb|EEE55297.1| hypothetical protein OsJ_03249 [Oryza sativa Japonica Group] Length = 706 Score = 61.2 bits (147), Expect = 5e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 2 SKVTQREIVIRDRNRFHHFRDGSCSCEDYW 91 SKV REIV+RDRNRFHHF+DG+CSC+DYW Sbjct: 677 SKVFNREIVMRDRNRFHHFKDGACSCKDYW 706