BLASTX nr result
ID: Akebia23_contig00013252
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00013252 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315411.1| calcium-dependent protein kinase 2 [Populus ... 62 6e-08 ref|XP_006584637.1| PREDICTED: calcium-dependent protein kinase ... 62 1e-07 ref|XP_004503020.1| PREDICTED: calcium-dependent protein kinase ... 62 1e-07 ref|NP_001238517.2| calcium-dependent protein kinase SK5 [Glycin... 62 1e-07 ref|XP_003526904.1| PREDICTED: calcium-dependent protein kinase ... 62 1e-07 ref|XP_003523190.1| PREDICTED: calcium-dependent protein kinase ... 62 1e-07 ref|XP_003602699.1| Calcium-dependent protein kinase [Medicago t... 62 1e-07 gb|AAV28169.1| calcium-dependent protein kinase 1 [Vicia faba] 62 1e-07 ref|NP_001241962.1| calcium-dependent protein kinase SK5-like [G... 62 1e-07 ref|XP_007019990.1| Calcium-dependent protein kinase 2 isoform 3... 61 1e-07 ref|XP_007019989.1| Calcium-dependent protein kinase 2 isoform 2... 61 1e-07 ref|XP_007019988.1| Calcium-dependent protein kinase 2 isoform 1... 61 1e-07 ref|XP_004290421.1| PREDICTED: calcium-dependent protein kinase ... 61 1e-07 ref|XP_007199799.1| hypothetical protein PRUPE_ppa004665mg [Prun... 61 1e-07 ref|XP_004147335.1| PREDICTED: calcium-dependent protein kinase ... 61 1e-07 dbj|BAB63464.1| calcium dependent protein kinase [Solanum tubero... 61 1e-07 ref|XP_002271759.2| PREDICTED: calcium-dependent protein kinase ... 61 1e-07 emb|CBI18175.3| unnamed protein product [Vitis vinifera] 61 1e-07 gb|EYU24096.1| hypothetical protein MIMGU_mgv1a005313mg [Mimulus... 61 2e-07 gb|EXB64077.1| Calcium-dependent protein kinase SK5 [Morus notab... 61 2e-07 >ref|XP_002315411.1| calcium-dependent protein kinase 2 [Populus trichocarpa] gi|222864451|gb|EEF01582.1| calcium-dependent protein kinase 2 [Populus trichocarpa] Length = 579 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +3 Query: 189 HPWIVDDGVPPYKPLDSAVLSHLMRFSTMNKFKKIALR 302 HPW+ +DGV P KPLDSAVLS L +FS MNKFKK+ALR Sbjct: 371 HPWVQEDGVAPDKPLDSAVLSRLKQFSAMNKFKKMALR 408 >ref|XP_006584637.1| PREDICTED: calcium-dependent protein kinase SK5 isoform X1 [Glycine max] Length = 537 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 189 HPWIVDDGVPPYKPLDSAVLSHLMRFSTMNKFKKIALR 302 HPWIVDD + P KPLDSAVLS L +FS MNK KK+ALR Sbjct: 318 HPWIVDDNIAPDKPLDSAVLSRLKQFSAMNKLKKMALR 355 >ref|XP_004503020.1| PREDICTED: calcium-dependent protein kinase SK5-like [Cicer arietinum] Length = 499 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 189 HPWIVDDGVPPYKPLDSAVLSHLMRFSTMNKFKKIALR 302 HPWIVDD + P KPLDSAVLS L +FS MNK KK+ALR Sbjct: 288 HPWIVDDNIAPDKPLDSAVLSRLKQFSAMNKLKKMALR 325 >ref|NP_001238517.2| calcium-dependent protein kinase SK5 [Glycine max] gi|116054|sp|P28583.1|CDPK_SOYBN RecName: Full=Calcium-dependent protein kinase SK5; Short=CDPK gi|169931|gb|AAB00806.1| calmcium/calmodulin-dependent protein kinase [Glycine max] Length = 508 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 189 HPWIVDDGVPPYKPLDSAVLSHLMRFSTMNKFKKIALR 302 HPWIVDD + P KPLDSAVLS L +FS MNK KK+ALR Sbjct: 289 HPWIVDDNIAPDKPLDSAVLSRLKQFSAMNKLKKMALR 326 >ref|XP_003526904.1| PREDICTED: calcium-dependent protein kinase SK5-like [Glycine max] Length = 497 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 189 HPWIVDDGVPPYKPLDSAVLSHLMRFSTMNKFKKIALR 302 HPWIVDD + P KPLDSAVLS L +FS MNK KK+ALR Sbjct: 286 HPWIVDDNIAPDKPLDSAVLSRLKQFSAMNKLKKMALR 323 >ref|XP_003523190.1| PREDICTED: calcium-dependent protein kinase SK5-like [Glycine max] Length = 496 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 189 HPWIVDDGVPPYKPLDSAVLSHLMRFSTMNKFKKIALR 302 HPWIVDD + P KPLDSAVLS L +FS MNK KK+ALR Sbjct: 285 HPWIVDDNIAPDKPLDSAVLSRLKQFSAMNKLKKMALR 322 >ref|XP_003602699.1| Calcium-dependent protein kinase [Medicago truncatula] gi|355491747|gb|AES72950.1| Calcium-dependent protein kinase [Medicago truncatula] Length = 495 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 189 HPWIVDDGVPPYKPLDSAVLSHLMRFSTMNKFKKIALR 302 HPWIVDD + P KPLDSAVLS L +FS MNK KK+ALR Sbjct: 284 HPWIVDDNIAPDKPLDSAVLSRLKQFSAMNKLKKMALR 321 >gb|AAV28169.1| calcium-dependent protein kinase 1 [Vicia faba] Length = 493 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 189 HPWIVDDGVPPYKPLDSAVLSHLMRFSTMNKFKKIALR 302 HPWIVDD + P KPLDSAVLS L +FS MNK KK+ALR Sbjct: 282 HPWIVDDSIAPDKPLDSAVLSRLKQFSAMNKLKKMALR 319 >ref|NP_001241962.1| calcium-dependent protein kinase SK5-like [Glycine max] gi|29892113|gb|AAP03012.1| seed calcium dependent protein kinase a [Glycine max] Length = 507 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 189 HPWIVDDGVPPYKPLDSAVLSHLMRFSTMNKFKKIALR 302 HPWIVDD + P KPLDSAVLS L +FS MNK KK+ALR Sbjct: 288 HPWIVDDNIAPDKPLDSAVLSRLKQFSAMNKLKKMALR 325 >ref|XP_007019990.1| Calcium-dependent protein kinase 2 isoform 3, partial [Theobroma cacao] gi|508725318|gb|EOY17215.1| Calcium-dependent protein kinase 2 isoform 3, partial [Theobroma cacao] Length = 466 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 189 HPWIVDDGVPPYKPLDSAVLSHLMRFSTMNKFKKIALR 302 HPWIVDD V P KPLDSAVLS L +FS MNK KK+ALR Sbjct: 288 HPWIVDDRVAPDKPLDSAVLSRLKQFSAMNKLKKMALR 325 >ref|XP_007019989.1| Calcium-dependent protein kinase 2 isoform 2 [Theobroma cacao] gi|590603375|ref|XP_007019991.1| Calcium-dependent protein kinase 2 isoform 2 [Theobroma cacao] gi|508725317|gb|EOY17214.1| Calcium-dependent protein kinase 2 isoform 2 [Theobroma cacao] gi|508725319|gb|EOY17216.1| Calcium-dependent protein kinase 2 isoform 2 [Theobroma cacao] Length = 386 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 189 HPWIVDDGVPPYKPLDSAVLSHLMRFSTMNKFKKIALR 302 HPWIVDD V P KPLDSAVLS L +FS MNK KK+ALR Sbjct: 288 HPWIVDDRVAPDKPLDSAVLSRLKQFSAMNKLKKMALR 325 >ref|XP_007019988.1| Calcium-dependent protein kinase 2 isoform 1 [Theobroma cacao] gi|508725316|gb|EOY17213.1| Calcium-dependent protein kinase 2 isoform 1 [Theobroma cacao] Length = 566 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 189 HPWIVDDGVPPYKPLDSAVLSHLMRFSTMNKFKKIALR 302 HPWIVDD V P KPLDSAVLS L +FS MNK KK+ALR Sbjct: 351 HPWIVDDRVAPDKPLDSAVLSRLKQFSAMNKLKKMALR 388 >ref|XP_004290421.1| PREDICTED: calcium-dependent protein kinase 11-like [Fragaria vesca subsp. vesca] Length = 490 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 189 HPWIVDDGVPPYKPLDSAVLSHLMRFSTMNKFKKIALR 302 HPWIVDD V P KPLDSAVLS L +FS MNK KK+ALR Sbjct: 276 HPWIVDDRVAPDKPLDSAVLSRLKQFSAMNKLKKMALR 313 >ref|XP_007199799.1| hypothetical protein PRUPE_ppa004665mg [Prunus persica] gi|462395199|gb|EMJ00998.1| hypothetical protein PRUPE_ppa004665mg [Prunus persica] Length = 497 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 189 HPWIVDDGVPPYKPLDSAVLSHLMRFSTMNKFKKIALR 302 HPWIVDD V P KPLDSAVLS L +FS MNK KK+ALR Sbjct: 285 HPWIVDDRVAPDKPLDSAVLSRLKQFSAMNKLKKMALR 322 >ref|XP_004147335.1| PREDICTED: calcium-dependent protein kinase SK5-like [Cucumis sativus] gi|449508715|ref|XP_004163390.1| PREDICTED: calcium-dependent protein kinase SK5-like [Cucumis sativus] Length = 503 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 189 HPWIVDDGVPPYKPLDSAVLSHLMRFSTMNKFKKIALR 302 HPWIVDD V P KPLDSAVLS L +FS MNK KK+ALR Sbjct: 285 HPWIVDDKVAPDKPLDSAVLSRLKQFSAMNKLKKMALR 322 >dbj|BAB63464.1| calcium dependent protein kinase [Solanum tuberosum] Length = 496 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 189 HPWIVDDGVPPYKPLDSAVLSHLMRFSTMNKFKKIALR 302 HPWIVDD V P KPLDSAVLS L +FS MNK KK+ALR Sbjct: 283 HPWIVDDTVAPDKPLDSAVLSRLKQFSAMNKLKKMALR 320 >ref|XP_002271759.2| PREDICTED: calcium-dependent protein kinase 4 [Vitis vinifera] Length = 626 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 189 HPWIVDDGVPPYKPLDSAVLSHLMRFSTMNKFKKIALR 302 HPWIVDD V P KPLDSAVLS L +FS MNK KK+ALR Sbjct: 415 HPWIVDDRVAPDKPLDSAVLSRLKQFSAMNKLKKMALR 452 >emb|CBI18175.3| unnamed protein product [Vitis vinifera] Length = 346 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 189 HPWIVDDGVPPYKPLDSAVLSHLMRFSTMNKFKKIALR 302 HPWIVDD V P KPLDSAVLS L +FS MNK KK+ALR Sbjct: 135 HPWIVDDRVAPDKPLDSAVLSRLKQFSAMNKLKKMALR 172 >gb|EYU24096.1| hypothetical protein MIMGU_mgv1a005313mg [Mimulus guttatus] Length = 489 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 189 HPWIVDDGVPPYKPLDSAVLSHLMRFSTMNKFKKIALR 302 HPWI+DD V P KPLDSAVLS L +FS MNK KK+ALR Sbjct: 283 HPWIIDDTVAPDKPLDSAVLSRLKQFSAMNKLKKMALR 320 >gb|EXB64077.1| Calcium-dependent protein kinase SK5 [Morus notabilis] Length = 508 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 189 HPWIVDDGVPPYKPLDSAVLSHLMRFSTMNKFKKIALR 302 HPWIVDD + P KPLDSAVLS L +FS MNK KK+ALR Sbjct: 293 HPWIVDDRIAPDKPLDSAVLSRLKQFSAMNKLKKMALR 330