BLASTX nr result
ID: Akebia23_contig00013192
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00013192 (415 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006854530.1| hypothetical protein AMTR_s00030p00033750 [A... 61 2e-07 ref|XP_006303490.1| hypothetical protein CARUB_v10010817mg [Caps... 59 5e-07 gb|AAD39640.1|AC007591_5 Similar to gb|X79273 cytochrome c reduc... 59 5e-07 ref|NP_172964.1| ubiquinol-cytochrome C reductase hinge protein ... 59 5e-07 gb|AFK40779.1| unknown [Lotus japonicus] 59 5e-07 ref|XP_002890088.1| predicted protein [Arabidopsis lyrata subsp.... 59 5e-07 ref|NP_001154342.1| ubiquinol-cytochrome C reductase hinge prote... 59 5e-07 gb|AAM63085.1| putative ubiquinol--cytochrome-c reductase [Arabi... 59 5e-07 ref|XP_002300923.2| hypothetical protein POPTR_0002s06980g [Popu... 59 9e-07 gb|EXB97277.1| Cytochrome b-c1 complex subunit 6 [Morus notabilis] 57 2e-06 ref|XP_006416942.1| hypothetical protein EUTSA_v10009667mg, part... 57 2e-06 ref|XP_002307493.1| ubiquinol-cytochrome C reductase complex 7.8... 57 3e-06 ref|XP_002307492.1| hypothetical protein POPTR_0005s21320g [Popu... 57 3e-06 ref|XP_002300924.2| hypothetical protein POPTR_0002s06990g [Popu... 56 5e-06 ref|XP_004485537.1| PREDICTED: cytochrome b-c1 complex subunit 6... 56 5e-06 ref|XP_007200654.1| hypothetical protein PRUPE_ppa014447mg [Prun... 56 5e-06 ref|XP_002532437.1| Ubiquinol-cytochrome c reductase complex 7.8... 56 5e-06 ref|XP_006493299.1| PREDICTED: cytochrome b-c1 complex subunit 6... 56 6e-06 ref|XP_006493298.1| PREDICTED: cytochrome b-c1 complex subunit 6... 56 6e-06 ref|XP_004485535.1| PREDICTED: cytochrome b-c1 complex subunit 6... 56 6e-06 >ref|XP_006854530.1| hypothetical protein AMTR_s00030p00033750 [Amborella trichopoda] gi|548858216|gb|ERN15997.1| hypothetical protein AMTR_s00030p00033750 [Amborella trichopoda] Length = 86 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +3 Query: 273 DEELVDPKKYLEESCKPKCVKPLLEYQV-VRRTN*TWTGQQ 392 DEELVDPK+YLEESCKPKCVKPLLEYQ V+R TG + Sbjct: 20 DEELVDPKQYLEESCKPKCVKPLLEYQACVKRIQGDETGHK 60 >ref|XP_006303490.1| hypothetical protein CARUB_v10010817mg [Capsella rubella] gi|482572201|gb|EOA36388.1| hypothetical protein CARUB_v10010817mg [Capsella rubella] Length = 69 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 273 DEELVDPKKYLEESCKPKCVKPLLEYQ 353 D+E+VDPKKYLEESCKPKCVKPLLEYQ Sbjct: 3 DDEVVDPKKYLEESCKPKCVKPLLEYQ 29 >gb|AAD39640.1|AC007591_5 Similar to gb|X79273 cytochrome c reductase hinge protein subunit from Solanum tuberosum. ESTs gb|T45282 and gb|T21596 come from this gene [Arabidopsis thaliana] Length = 101 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 273 DEELVDPKKYLEESCKPKCVKPLLEYQ 353 D+E+VDPKKYLEESCKPKCVKPLLEYQ Sbjct: 16 DDEVVDPKKYLEESCKPKCVKPLLEYQ 42 >ref|NP_172964.1| ubiquinol-cytochrome C reductase hinge protein [Arabidopsis thaliana] gi|110740918|dbj|BAE98555.1| ubiquinol-cytochrome-c reductase like protein [Arabidopsis thaliana] gi|114050691|gb|ABI49495.1| At1g15120 [Arabidopsis thaliana] gi|227204459|dbj|BAH57081.1| AT1G15120 [Arabidopsis thaliana] gi|332191146|gb|AEE29267.1| ubiquinol-cytochrome C reductase hinge protein [Arabidopsis thaliana] Length = 69 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 273 DEELVDPKKYLEESCKPKCVKPLLEYQ 353 D+E+VDPKKYLEESCKPKCVKPLLEYQ Sbjct: 3 DDEVVDPKKYLEESCKPKCVKPLLEYQ 29 >gb|AFK40779.1| unknown [Lotus japonicus] Length = 69 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +3 Query: 273 DEELVDPKKYLEESCKPKCVKPLLEYQV-VRRTN*TWTGQQ 392 DEE VDPK YLEESCKPKCVKPLLEYQ V+R + TGQ+ Sbjct: 3 DEEPVDPKGYLEESCKPKCVKPLLEYQACVKRIHGDETGQK 43 >ref|XP_002890088.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297335930|gb|EFH66347.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 69 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 273 DEELVDPKKYLEESCKPKCVKPLLEYQ 353 D+E+VDPKKYLEESCKPKCVKPLLEYQ Sbjct: 3 DDEVVDPKKYLEESCKPKCVKPLLEYQ 29 >ref|NP_001154342.1| ubiquinol-cytochrome C reductase hinge protein [Arabidopsis thaliana] gi|332191147|gb|AEE29268.1| ubiquinol-cytochrome C reductase hinge protein [Arabidopsis thaliana] Length = 166 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 273 DEELVDPKKYLEESCKPKCVKPLLEYQ 353 D+E+VDPKKYLEESCKPKCVKPLLEYQ Sbjct: 70 DDEVVDPKKYLEESCKPKCVKPLLEYQ 96 >gb|AAM63085.1| putative ubiquinol--cytochrome-c reductase [Arabidopsis thaliana] Length = 69 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 273 DEELVDPKKYLEESCKPKCVKPLLEYQ 353 D+E+VDPKKYLEESCKPKCVKPLLEYQ Sbjct: 3 DDEVVDPKKYLEESCKPKCVKPLLEYQ 29 >ref|XP_002300923.2| hypothetical protein POPTR_0002s06980g [Populus trichocarpa] gi|550344443|gb|EEE80196.2| hypothetical protein POPTR_0002s06980g [Populus trichocarpa] Length = 210 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/41 (70%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +3 Query: 273 DEELVDPKKYLEESCKPKCVKPLLEYQV-VRRTN*TWTGQQ 392 DEE VDPKKYLEESCKPKCV+PLLEYQ V+R TG + Sbjct: 144 DEEPVDPKKYLEESCKPKCVRPLLEYQACVKRIQGDETGHK 184 >gb|EXB97277.1| Cytochrome b-c1 complex subunit 6 [Morus notabilis] Length = 211 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +3 Query: 273 DEELVDPKKYLEESCKPKCVKPLLEYQV-VRRTN*TWTGQQ 392 D+E VDPKKYLEE+CKPKCVKPLLEYQ V+R TG + Sbjct: 59 DDEPVDPKKYLEEACKPKCVKPLLEYQACVKRIQGDETGHK 99 >ref|XP_006416942.1| hypothetical protein EUTSA_v10009667mg, partial [Eutrema salsugineum] gi|557094713|gb|ESQ35295.1| hypothetical protein EUTSA_v10009667mg, partial [Eutrema salsugineum] Length = 109 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 273 DEELVDPKKYLEESCKPKCVKPLLEYQ 353 D+E+VDPKKYLEESCKPKCVKPLL YQ Sbjct: 24 DDEVVDPKKYLEESCKPKCVKPLLSYQ 50 >ref|XP_002307493.1| ubiquinol-cytochrome C reductase complex 7.8 kDa family protein [Populus trichocarpa] gi|222856942|gb|EEE94489.1| ubiquinol-cytochrome C reductase complex 7.8 kDa family protein [Populus trichocarpa] Length = 69 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 273 DEELVDPKKYLEESCKPKCVKPLLEYQ 353 DEE VDPKKYLEE+CKPKCV+PLLEYQ Sbjct: 3 DEEPVDPKKYLEEACKPKCVRPLLEYQ 29 >ref|XP_002307492.1| hypothetical protein POPTR_0005s21320g [Populus trichocarpa] gi|222856941|gb|EEE94488.1| hypothetical protein POPTR_0005s21320g [Populus trichocarpa] Length = 69 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +3 Query: 273 DEELVDPKKYLEESCKPKCVKPLLEYQV-VRRTN*TWTGQQ 392 DEELVD KKYLE+SCKPKCVKPLLEY+ V+R T Q+ Sbjct: 3 DEELVDQKKYLEDSCKPKCVKPLLEYEACVKRVEGDDTSQK 43 >ref|XP_002300924.2| hypothetical protein POPTR_0002s06990g [Populus trichocarpa] gi|550344445|gb|EEE80197.2| hypothetical protein POPTR_0002s06990g [Populus trichocarpa] Length = 112 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 273 DEELVDPKKYLEESCKPKCVKPLLEYQ 353 DEELVD KKYLE+SCKPKCVKPLLEY+ Sbjct: 46 DEELVDQKKYLEDSCKPKCVKPLLEYE 72 >ref|XP_004485537.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Cicer arietinum] Length = 69 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +3 Query: 273 DEELVDPKKYLEESCKPKCVKPLLEYQV-VRRTN*TWTGQQ 392 DEE VD K+YLE+SCKPKCVKPLLEYQ V+R TGQ+ Sbjct: 3 DEEPVDQKRYLEDSCKPKCVKPLLEYQACVKRIQGDETGQK 43 >ref|XP_007200654.1| hypothetical protein PRUPE_ppa014447mg [Prunus persica] gi|462396054|gb|EMJ01853.1| hypothetical protein PRUPE_ppa014447mg [Prunus persica] Length = 69 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 273 DEELVDPKKYLEESCKPKCVKPLLEYQ 353 DEELVD KKYLEESC+PKCVKPL+EYQ Sbjct: 3 DEELVDQKKYLEESCQPKCVKPLIEYQ 29 >ref|XP_002532437.1| Ubiquinol-cytochrome c reductase complex 7.8 kDa protein, putative [Ricinus communis] gi|223527857|gb|EEF29952.1| Ubiquinol-cytochrome c reductase complex 7.8 kDa protein, putative [Ricinus communis] Length = 128 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +3 Query: 273 DEELVDPKKYLEESCKPKCVKPLLEYQV-VRRTN*TWTGQQ 392 DEELVD K+YLE+SCKPKCVKPL+EY+ ++RT GQ+ Sbjct: 22 DEELVDQKRYLEDSCKPKCVKPLIEYEACIKRTEGEDPGQK 62 >ref|XP_006493299.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X2 [Citrus sinensis] gi|568880810|ref|XP_006493300.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X3 [Citrus sinensis] Length = 69 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +3 Query: 273 DEELVDPKKYLEESCKPKCVKPLLEYQ 353 DEELVD KKY EE+CKPKCVKPLLEYQ Sbjct: 3 DEELVDQKKYFEEACKPKCVKPLLEYQ 29 >ref|XP_006493298.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X1 [Citrus sinensis] Length = 87 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +3 Query: 273 DEELVDPKKYLEESCKPKCVKPLLEYQ 353 DEELVD KKY EE+CKPKCVKPLLEYQ Sbjct: 21 DEELVDQKKYFEEACKPKCVKPLLEYQ 47 >ref|XP_004485535.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Cicer arietinum] Length = 69 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +3 Query: 273 DEELVDPKKYLEESCKPKCVKPLLEYQV-VRRTN*TWTGQQ 392 DEE VD K+YLEESCKPKCVKPLLEYQ V+R + +GQ+ Sbjct: 3 DEEPVDQKRYLEESCKPKCVKPLLEYQACVKRIHGDDSGQK 43