BLASTX nr result
ID: Akebia23_contig00013123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00013123 (531 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006475596.1| PREDICTED: arginine--tRNA ligase, cytoplasmi... 57 2e-06 ref|XP_006451331.1| hypothetical protein CICLE_v10007707mg [Citr... 57 2e-06 ref|XP_006451330.1| hypothetical protein CICLE_v10007707mg [Citr... 57 2e-06 ref|XP_006451327.1| hypothetical protein CICLE_v10007707mg [Citr... 57 2e-06 ref|XP_006451326.1| hypothetical protein CICLE_v10007707mg [Citr... 57 2e-06 ref|XP_006451324.1| hypothetical protein CICLE_v10007707mg [Citr... 57 2e-06 gb|EMT08576.1| Arginyl-tRNA synthetase [Aegilops tauschii] 57 3e-06 emb|CBI27986.3| unnamed protein product [Vitis vinifera] 56 5e-06 ref|XP_002280299.1| PREDICTED: arginyl-tRNA synthetase-like [Vit... 56 5e-06 >ref|XP_006475596.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X4 [Citrus sinensis] Length = 555 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -2 Query: 506 YRLNEEKVEWIIYVTDVGQSLHFEMVFS 423 YRLNEEK EWIIYVTDVGQ LHF+MVFS Sbjct: 387 YRLNEEKAEWIIYVTDVGQQLHFDMVFS 414 >ref|XP_006451331.1| hypothetical protein CICLE_v10007707mg [Citrus clementina] gi|557554557|gb|ESR64571.1| hypothetical protein CICLE_v10007707mg [Citrus clementina] Length = 546 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -2 Query: 506 YRLNEEKVEWIIYVTDVGQSLHFEMVFS 423 YRLNEEK EWIIYVTDVGQ LHF+MVFS Sbjct: 288 YRLNEEKAEWIIYVTDVGQQLHFDMVFS 315 >ref|XP_006451330.1| hypothetical protein CICLE_v10007707mg [Citrus clementina] gi|568843388|ref|XP_006475593.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 [Citrus sinensis] gi|557554556|gb|ESR64570.1| hypothetical protein CICLE_v10007707mg [Citrus clementina] Length = 645 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -2 Query: 506 YRLNEEKVEWIIYVTDVGQSLHFEMVFS 423 YRLNEEK EWIIYVTDVGQ LHF+MVFS Sbjct: 387 YRLNEEKAEWIIYVTDVGQQLHFDMVFS 414 >ref|XP_006451327.1| hypothetical protein CICLE_v10007707mg [Citrus clementina] gi|567918644|ref|XP_006451328.1| hypothetical protein CICLE_v10007707mg [Citrus clementina] gi|567918646|ref|XP_006451329.1| hypothetical protein CICLE_v10007707mg [Citrus clementina] gi|568843390|ref|XP_006475594.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 [Citrus sinensis] gi|568843392|ref|XP_006475595.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X3 [Citrus sinensis] gi|557554553|gb|ESR64567.1| hypothetical protein CICLE_v10007707mg [Citrus clementina] gi|557554554|gb|ESR64568.1| hypothetical protein CICLE_v10007707mg [Citrus clementina] gi|557554555|gb|ESR64569.1| hypothetical protein CICLE_v10007707mg [Citrus clementina] Length = 589 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -2 Query: 506 YRLNEEKVEWIIYVTDVGQSLHFEMVFS 423 YRLNEEK EWIIYVTDVGQ LHF+MVFS Sbjct: 331 YRLNEEKAEWIIYVTDVGQQLHFDMVFS 358 >ref|XP_006451326.1| hypothetical protein CICLE_v10007707mg [Citrus clementina] gi|557554552|gb|ESR64566.1| hypothetical protein CICLE_v10007707mg [Citrus clementina] Length = 575 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -2 Query: 506 YRLNEEKVEWIIYVTDVGQSLHFEMVFS 423 YRLNEEK EWIIYVTDVGQ LHF+MVFS Sbjct: 387 YRLNEEKAEWIIYVTDVGQQLHFDMVFS 414 >ref|XP_006451324.1| hypothetical protein CICLE_v10007707mg [Citrus clementina] gi|567918638|ref|XP_006451325.1| hypothetical protein CICLE_v10007707mg [Citrus clementina] gi|557554550|gb|ESR64564.1| hypothetical protein CICLE_v10007707mg [Citrus clementina] gi|557554551|gb|ESR64565.1| hypothetical protein CICLE_v10007707mg [Citrus clementina] Length = 519 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -2 Query: 506 YRLNEEKVEWIIYVTDVGQSLHFEMVFS 423 YRLNEEK EWIIYVTDVGQ LHF+MVFS Sbjct: 331 YRLNEEKAEWIIYVTDVGQQLHFDMVFS 358 >gb|EMT08576.1| Arginyl-tRNA synthetase [Aegilops tauschii] Length = 762 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -2 Query: 506 YRLNEEKVEWIIYVTDVGQSLHFEMVFSVCIFRHLYL 396 YRLN EK EWIIYVTDVGQ HF+M F C HL+L Sbjct: 511 YRLNVEKAEWIIYVTDVGQQQHFDMFFKACTKCHLFL 547 >emb|CBI27986.3| unnamed protein product [Vitis vinifera] Length = 691 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -2 Query: 506 YRLNEEKVEWIIYVTDVGQSLHFEMVFS 423 YRLNEEK EWIIYVTDVGQ HFEMVFS Sbjct: 433 YRLNEEKAEWIIYVTDVGQQQHFEMVFS 460 >ref|XP_002280299.1| PREDICTED: arginyl-tRNA synthetase-like [Vitis vinifera] Length = 649 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -2 Query: 506 YRLNEEKVEWIIYVTDVGQSLHFEMVFS 423 YRLNEEK EWIIYVTDVGQ HFEMVFS Sbjct: 391 YRLNEEKAEWIIYVTDVGQQQHFEMVFS 418