BLASTX nr result
ID: Akebia23_contig00012973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00012973 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL78659.1|AF405557_1 reverse transcriptase [Fagus sylvatica] 54 2e-07 >gb|AAL78659.1|AF405557_1 reverse transcriptase [Fagus sylvatica] Length = 168 Score = 53.5 bits (127), Expect(2) = 2e-07 Identities = 23/56 (41%), Positives = 39/56 (69%), Gaps = 4/56 (7%) Frame = +2 Query: 59 ISSVIVHEQETFIKDRKIL----VVNKCIDTR*RTNLRGMVCKINLEKAYDHVTRD 214 + SVI Q +F+ R+IL + N+C+D+R ++ + G++CK+++EKAYDHV D Sbjct: 26 LDSVISESQNSFVGGRQILDSVLIANECLDSRIKSGIPGLICKLDIEKAYDHVNWD 81 Score = 26.9 bits (58), Expect(2) = 2e-07 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +3 Query: 3 GPIYKIIAKVLVDMLKVVI 59 G IYK++AKVL + LK+V+ Sbjct: 8 GSIYKLLAKVLANRLKLVL 26