BLASTX nr result
ID: Akebia23_contig00012687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00012687 (454 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007221785.1| hypothetical protein PRUPE_ppa005725mg [Prun... 43 5e-06 >ref|XP_007221785.1| hypothetical protein PRUPE_ppa005725mg [Prunus persica] gi|462418721|gb|EMJ22984.1| hypothetical protein PRUPE_ppa005725mg [Prunus persica] Length = 446 Score = 42.7 bits (99), Expect(2) = 5e-06 Identities = 35/76 (46%), Positives = 39/76 (51%), Gaps = 4/76 (5%) Frame = +3 Query: 237 QESK-SWVS---VSKLTNYSFITNFRIPVAVPNIFNPTPNSRXXXXXXXXXXXXXXXXXX 404 Q+SK SWVS VSKL + SFI+ R+P VPNI PTPNS Sbjct: 55 QDSKLSWVSHISVSKLADLSFISRIRVP--VPNINFPTPNS-----GGKFVPKLLYSSVA 107 Query: 405 FPPVLLFPYQSAKLAK 452 PVLL YQSA L K Sbjct: 108 SSPVLLNLYQSADLVK 123 Score = 33.1 bits (74), Expect(2) = 5e-06 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +1 Query: 67 MGSLSGIFQRPLTXXXXXXXXXLSTDLPDKVP 162 M SLSGI QRPL +STD+ DK+P Sbjct: 1 MASLSGIVQRPLVAAAALAVASVSTDISDKLP 32