BLASTX nr result
ID: Akebia23_contig00009439
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00009439 (324 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI38451.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_002266132.2| PREDICTED: LOW QUALITY PROTEIN: lipoyl synth... 64 2e-08 gb|EPS65537.1| lipoyl synthase, mitochondrial, partial [Genlisea... 63 4e-08 ref|XP_006382932.1| hypothetical protein POPTR_0005s08840g [Popu... 62 6e-08 ref|XP_002306361.1| lipoic acid synthase family protein [Populus... 62 6e-08 gb|ABK96318.1| unknown [Populus trichocarpa x Populus deltoides] 62 6e-08 gb|EYU26119.1| hypothetical protein MIMGU_mgv1a008134mg [Mimulus... 62 8e-08 gb|AHM22930.1| lipoyl synthase [Nicotiana tabacum] 62 8e-08 gb|EXB62277.1| Lipoyl synthase [Morus notabilis] 62 8e-08 ref|XP_006653475.1| PREDICTED: lipoyl synthase, mitochondrial-li... 62 8e-08 ref|XP_006357526.1| PREDICTED: lipoyl synthase, mitochondrial-li... 62 8e-08 ref|XP_007149882.1| hypothetical protein PHAVU_005G106700g [Phas... 62 8e-08 ref|XP_007149469.1| hypothetical protein PHAVU_005G072800g [Phas... 62 8e-08 ref|XP_006447321.1| hypothetical protein CICLE_v10015632mg [Citr... 62 8e-08 ref|XP_006447320.1| hypothetical protein CICLE_v10015632mg [Citr... 62 8e-08 ref|XP_006409024.1| hypothetical protein EUTSA_v10002016mg [Eutr... 62 8e-08 ref|XP_006382933.1| hypothetical protein POPTR_0005s08840g [Popu... 62 8e-08 ref|XP_006380479.1| hypothetical protein POPTR_0007s06900g [Popu... 62 8e-08 ref|XP_004975823.1| PREDICTED: lipoyl synthase, mitochondrial-li... 62 8e-08 ref|XP_007043522.1| Lipoyl synthase, mitochondrial isoform 1 [Th... 62 8e-08 >emb|CBI38451.3| unnamed protein product [Vitis vinifera] Length = 178 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 323 GFRYIASGPMVRSSYKAGEFYIKSMIEADRGM 228 GFRY+ASGPMVRSSYKAGEFYIKSMI+ADR M Sbjct: 134 GFRYVASGPMVRSSYKAGEFYIKSMIDADRAM 165 >ref|XP_002266132.2| PREDICTED: LOW QUALITY PROTEIN: lipoyl synthase, mitochondrial [Vitis vinifera] gi|308191441|sp|A5CB81.1|LIAS_VITVI RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic acid synthase; Flags: Precursor gi|147825263|emb|CAN73265.1| hypothetical protein VITISV_021769 [Vitis vinifera] Length = 393 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 323 GFRYIASGPMVRSSYKAGEFYIKSMIEADRGM 228 GFRY+ASGPMVRSSYKAGEFYIKSMI+ADR M Sbjct: 349 GFRYVASGPMVRSSYKAGEFYIKSMIDADRAM 380 >gb|EPS65537.1| lipoyl synthase, mitochondrial, partial [Genlisea aurea] Length = 340 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 323 GFRYIASGPMVRSSYKAGEFYIKSMIEADR 234 GFRY+ASGPMVRSSYKAGEFYIKSMIEADR Sbjct: 308 GFRYVASGPMVRSSYKAGEFYIKSMIEADR 337 >ref|XP_006382932.1| hypothetical protein POPTR_0005s08840g [Populus trichocarpa] gi|550338434|gb|ERP60729.1| hypothetical protein POPTR_0005s08840g [Populus trichocarpa] Length = 349 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 323 GFRYIASGPMVRSSYKAGEFYIKSMIEADRGM 228 GFRY+ASGPMVRSSYKAGEFYIKSMIE+DR + Sbjct: 311 GFRYVASGPMVRSSYKAGEFYIKSMIESDRSV 342 >ref|XP_002306361.1| lipoic acid synthase family protein [Populus trichocarpa] gi|308191438|sp|B9H5L9.1|LIAS_POPTR RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic acid synthase; Flags: Precursor gi|222855810|gb|EEE93357.1| lipoic acid synthase family protein [Populus trichocarpa] Length = 385 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 323 GFRYIASGPMVRSSYKAGEFYIKSMIEADRGM 228 GFRY+ASGPMVRSSYKAGEFYIKSMIE+DR + Sbjct: 347 GFRYVASGPMVRSSYKAGEFYIKSMIESDRSV 378 >gb|ABK96318.1| unknown [Populus trichocarpa x Populus deltoides] Length = 385 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 323 GFRYIASGPMVRSSYKAGEFYIKSMIEADRGM 228 GFRY+ASGPMVRSSYKAGEFYIKSMIE+DR + Sbjct: 347 GFRYVASGPMVRSSYKAGEFYIKSMIESDRSV 378 >gb|EYU26119.1| hypothetical protein MIMGU_mgv1a008134mg [Mimulus guttatus] Length = 383 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 323 GFRYIASGPMVRSSYKAGEFYIKSMIEADR 234 GFRY+ASGPMVRSSYKAGEFYIKSMIE+DR Sbjct: 348 GFRYVASGPMVRSSYKAGEFYIKSMIESDR 377 >gb|AHM22930.1| lipoyl synthase [Nicotiana tabacum] Length = 385 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 323 GFRYIASGPMVRSSYKAGEFYIKSMIEADR 234 GFRY+ASGPMVRSSYKAGEFYIKSMIE+DR Sbjct: 351 GFRYVASGPMVRSSYKAGEFYIKSMIESDR 380 >gb|EXB62277.1| Lipoyl synthase [Morus notabilis] Length = 384 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 323 GFRYIASGPMVRSSYKAGEFYIKSMIEADR 234 GFRY+ASGPMVRSSYKAGEFYIKSMIE+DR Sbjct: 346 GFRYVASGPMVRSSYKAGEFYIKSMIESDR 375 >ref|XP_006653475.1| PREDICTED: lipoyl synthase, mitochondrial-like, partial [Oryza brachyantha] Length = 319 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 323 GFRYIASGPMVRSSYKAGEFYIKSMIEADR 234 GFRY+ASGPMVRSSYKAGEFYIK+MIEADR Sbjct: 280 GFRYVASGPMVRSSYKAGEFYIKAMIEADR 309 >ref|XP_006357526.1| PREDICTED: lipoyl synthase, mitochondrial-like [Solanum tuberosum] Length = 380 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 323 GFRYIASGPMVRSSYKAGEFYIKSMIEADR 234 GFRY+ASGPMVRSSYKAGEFYIKSMIE+DR Sbjct: 346 GFRYVASGPMVRSSYKAGEFYIKSMIESDR 375 >ref|XP_007149882.1| hypothetical protein PHAVU_005G106700g [Phaseolus vulgaris] gi|561023146|gb|ESW21876.1| hypothetical protein PHAVU_005G106700g [Phaseolus vulgaris] Length = 381 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 323 GFRYIASGPMVRSSYKAGEFYIKSMIEADR 234 GFRY+ASGPMVRSSYKAGEFYIKSMIE+DR Sbjct: 342 GFRYVASGPMVRSSYKAGEFYIKSMIESDR 371 >ref|XP_007149469.1| hypothetical protein PHAVU_005G072800g [Phaseolus vulgaris] gi|561022733|gb|ESW21463.1| hypothetical protein PHAVU_005G072800g [Phaseolus vulgaris] Length = 377 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 323 GFRYIASGPMVRSSYKAGEFYIKSMIEADR 234 GFRY+ASGPMVRSSYKAGEFYIKSMIE+DR Sbjct: 342 GFRYVASGPMVRSSYKAGEFYIKSMIESDR 371 >ref|XP_006447321.1| hypothetical protein CICLE_v10015632mg [Citrus clementina] gi|568877192|ref|XP_006491631.1| PREDICTED: lipoyl synthase, mitochondrial-like [Citrus sinensis] gi|557549932|gb|ESR60561.1| hypothetical protein CICLE_v10015632mg [Citrus clementina] Length = 376 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 323 GFRYIASGPMVRSSYKAGEFYIKSMIEADR 234 GFRY+ASGPMVRSSYKAGEFYIKSMIE+DR Sbjct: 342 GFRYVASGPMVRSSYKAGEFYIKSMIESDR 371 >ref|XP_006447320.1| hypothetical protein CICLE_v10015632mg [Citrus clementina] gi|557549931|gb|ESR60560.1| hypothetical protein CICLE_v10015632mg [Citrus clementina] Length = 363 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 323 GFRYIASGPMVRSSYKAGEFYIKSMIEADR 234 GFRY+ASGPMVRSSYKAGEFYIKSMIE+DR Sbjct: 329 GFRYVASGPMVRSSYKAGEFYIKSMIESDR 358 >ref|XP_006409024.1| hypothetical protein EUTSA_v10002016mg [Eutrema salsugineum] gi|557110180|gb|ESQ50477.1| hypothetical protein EUTSA_v10002016mg [Eutrema salsugineum] Length = 373 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 323 GFRYIASGPMVRSSYKAGEFYIKSMIEADR 234 GFRY+ASGPMVRSSYKAGE+YIKSMIEADR Sbjct: 337 GFRYVASGPMVRSSYKAGEYYIKSMIEADR 366 >ref|XP_006382933.1| hypothetical protein POPTR_0005s08840g [Populus trichocarpa] gi|550338435|gb|ERP60730.1| hypothetical protein POPTR_0005s08840g [Populus trichocarpa] Length = 372 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 323 GFRYIASGPMVRSSYKAGEFYIKSMIEADR 234 GFRY+ASGPMVRSSYKAGEFYIKSMIE+DR Sbjct: 311 GFRYVASGPMVRSSYKAGEFYIKSMIESDR 340 >ref|XP_006380479.1| hypothetical protein POPTR_0007s06900g [Populus trichocarpa] gi|550334297|gb|ERP58276.1| hypothetical protein POPTR_0007s06900g [Populus trichocarpa] Length = 385 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 323 GFRYIASGPMVRSSYKAGEFYIKSMIEADR 234 GFRY+ASGPMVRSSYKAGEFYIKSMIE+DR Sbjct: 347 GFRYVASGPMVRSSYKAGEFYIKSMIESDR 376 >ref|XP_004975823.1| PREDICTED: lipoyl synthase, mitochondrial-like [Setaria italica] Length = 385 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 323 GFRYIASGPMVRSSYKAGEFYIKSMIEADR 234 GFRY+ASGPMVRSSYKAGEFYIK+MIEADR Sbjct: 346 GFRYVASGPMVRSSYKAGEFYIKAMIEADR 375 >ref|XP_007043522.1| Lipoyl synthase, mitochondrial isoform 1 [Theobroma cacao] gi|508707457|gb|EOX99353.1| Lipoyl synthase, mitochondrial isoform 1 [Theobroma cacao] Length = 376 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 323 GFRYIASGPMVRSSYKAGEFYIKSMIEADR 234 GFRY+ASGPMVRSSYKAGEFYIKSMIE+DR Sbjct: 342 GFRYVASGPMVRSSYKAGEFYIKSMIESDR 371