BLASTX nr result
ID: Akebia23_contig00009095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00009095 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006409204.1| hypothetical protein EUTSA_v10022812mg [Eutr... 57 3e-06 ref|XP_006409203.1| hypothetical protein EUTSA_v10022812mg [Eutr... 57 3e-06 ref|NP_568522.1| RNA recognition motif (RRM)-containing protein ... 56 6e-06 ref|XP_006284322.1| hypothetical protein CARUB_v10005495mg [Caps... 56 6e-06 ref|XP_002868391.1| RNA recognition motif-containing protein [Ar... 56 6e-06 gb|EXB31241.1| hypothetical protein L484_014722 [Morus notabilis] 55 8e-06 >ref|XP_006409204.1| hypothetical protein EUTSA_v10022812mg [Eutrema salsugineum] gi|557110366|gb|ESQ50657.1| hypothetical protein EUTSA_v10022812mg [Eutrema salsugineum] Length = 262 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +3 Query: 171 YVTAGAHWFSGAFNKVAKVGQVASSKTREKISVS 272 YVTAGA WFSGAF+KVA+VGQ+ASSKT+EK +++ Sbjct: 216 YVTAGAAWFSGAFSKVARVGQIASSKTKEKFNLA 249 >ref|XP_006409203.1| hypothetical protein EUTSA_v10022812mg [Eutrema salsugineum] gi|557110365|gb|ESQ50656.1| hypothetical protein EUTSA_v10022812mg [Eutrema salsugineum] Length = 260 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +3 Query: 171 YVTAGAHWFSGAFNKVAKVGQVASSKTREKISVS 272 YVTAGA WFSGAF+KVA+VGQ+ASSKT+EK +++ Sbjct: 214 YVTAGAAWFSGAFSKVARVGQIASSKTKEKFNLA 247 >ref|NP_568522.1| RNA recognition motif (RRM)-containing protein [Arabidopsis thaliana] gi|21593919|gb|AAM65884.1| unknown [Arabidopsis thaliana] gi|26450493|dbj|BAC42360.1| unknown protein [Arabidopsis thaliana] gi|28973403|gb|AAO64026.1| putative RRM-containing protein [Arabidopsis thaliana] gi|332006499|gb|AED93882.1| RNA recognition motif (RRM)-containing protein [Arabidopsis thaliana] Length = 267 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +3 Query: 171 YVTAGAHWFSGAFNKVAKVGQVASSKTREKISVS 272 YVTAGA WFSGAF+KVA+VGQVA SKT+EK +++ Sbjct: 221 YVTAGAAWFSGAFSKVARVGQVAGSKTKEKFNLA 254 >ref|XP_006284322.1| hypothetical protein CARUB_v10005495mg [Capsella rubella] gi|482553027|gb|EOA17220.1| hypothetical protein CARUB_v10005495mg [Capsella rubella] Length = 268 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +3 Query: 171 YVTAGAHWFSGAFNKVAKVGQVASSKTREKISVS 272 YVTAGA WFSGAF+KVA+VGQVA SKT+EK +++ Sbjct: 222 YVTAGAAWFSGAFSKVARVGQVAGSKTKEKFNLA 255 >ref|XP_002868391.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297314227|gb|EFH44650.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 267 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +3 Query: 171 YVTAGAHWFSGAFNKVAKVGQVASSKTREKISVS 272 YVTAGA WFSGAF+KVA+VGQVA SKT+EK +++ Sbjct: 221 YVTAGAAWFSGAFSKVARVGQVAGSKTKEKFNLA 254 >gb|EXB31241.1| hypothetical protein L484_014722 [Morus notabilis] Length = 450 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = +3 Query: 171 YVTAGAHWFSGAFNKVAKVGQVASSKTREKISVSWIRLDCNRTIRVD 311 YVTAGA W +GAF+KVA+ GQVA +KTREK +++ L T+ VD Sbjct: 397 YVTAGAAWLNGAFSKVARAGQVAGTKTREKFNLAVSNLTAKLTLAVD 443