BLASTX nr result
ID: Akebia23_contig00008499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00008499 (487 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007042050.1| MATE efflux family protein isoform 1 [Theobr... 42 8e-07 >ref|XP_007042050.1| MATE efflux family protein isoform 1 [Theobroma cacao] gi|508705985|gb|EOX97881.1| MATE efflux family protein isoform 1 [Theobroma cacao] Length = 558 Score = 42.4 bits (98), Expect(2) = 8e-07 Identities = 18/22 (81%), Positives = 21/22 (95%) Frame = -3 Query: 482 GLPGC*WALVGFQWARFSLALK 417 GLPGC +ALVGFQWARFSL+L+ Sbjct: 512 GLPGCWFALVGFQWARFSLSLQ 533 Score = 36.2 bits (82), Expect(2) = 8e-07 Identities = 16/31 (51%), Positives = 23/31 (74%) Frame = -1 Query: 433 FPLLLRHLTSPHGLLYSEDFSEHQLGKLNAA 341 F L L+ L SP+G+LYSED ++++ KL AA Sbjct: 528 FSLSLQRLLSPNGILYSEDLRQYEVKKLRAA 558