BLASTX nr result
ID: Akebia23_contig00008166
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00008166 (630 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006360993.1| PREDICTED: putative cyclin-dependent serine/... 57 4e-06 ref|XP_004291043.1| PREDICTED: uncharacterized protein LOC101310... 57 4e-06 ref|XP_004245097.1| PREDICTED: uncharacterized protein LOC101258... 57 4e-06 >ref|XP_006360993.1| PREDICTED: putative cyclin-dependent serine/threonine-protein kinase DDB_G0272797/DDB_G0274007-like [Solanum tuberosum] Length = 356 Score = 57.0 bits (136), Expect = 4e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +3 Query: 237 WAYMNSWFTPALLFVLLNIVIGTIAFGPSIGTKKH 341 WA MNSWFTP +LFVLLN++IGTIAF S+ +KH Sbjct: 14 WASMNSWFTPTVLFVLLNVMIGTIAFTSSLANQKH 48 >ref|XP_004291043.1| PREDICTED: uncharacterized protein LOC101310484 [Fragaria vesca subsp. vesca] Length = 313 Score = 57.0 bits (136), Expect = 4e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +3 Query: 237 WAYMNSWFTPALLFVLLNIVIGTIAFGPSIGTKKH 341 WA MNSW TP +LFVLLN++IGTIA S+GT+KH Sbjct: 14 WASMNSWLTPTVLFVLLNLMIGTIAIASSLGTQKH 48 >ref|XP_004245097.1| PREDICTED: uncharacterized protein LOC101258979 [Solanum lycopersicum] Length = 343 Score = 57.0 bits (136), Expect = 4e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +3 Query: 237 WAYMNSWFTPALLFVLLNIVIGTIAFGPSIGTKKH 341 WA MNSWFTP +LFVLLN++IGTIAF S+ +KH Sbjct: 14 WASMNSWFTPTVLFVLLNVMIGTIAFTSSLANQKH 48