BLASTX nr result
ID: Akebia23_contig00008122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00008122 (501 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006280424.1| hypothetical protein CARUB_v10026357mg [Caps... 92 6e-17 gb|AFW88754.1| hypothetical protein ZEAMMB73_978741 [Zea mays] 92 6e-17 gb|EYU41647.1| hypothetical protein MIMGU_mgv1a002467mg [Mimulus... 91 2e-16 gb|EYU41646.1| hypothetical protein MIMGU_mgv1a002467mg [Mimulus... 91 2e-16 gb|EXC33207.1| Two-component response regulator-like protein [Mo... 91 2e-16 ref|XP_006594103.1| PREDICTED: two-component response regulator-... 91 2e-16 ref|XP_006588746.1| PREDICTED: two-component response regulator-... 91 2e-16 ref|XP_006588745.1| PREDICTED: two-component response regulator-... 91 2e-16 ref|XP_007027202.1| Sensory transduction histidine kinase, putat... 91 2e-16 ref|XP_007027200.1| Sensory transduction histidine kinase, putat... 91 2e-16 ref|XP_007027197.1| Sensory transduction histidine kinase, putat... 91 2e-16 ref|XP_004169415.1| PREDICTED: two-component response regulator-... 91 2e-16 ref|XP_004142221.1| PREDICTED: two-component response regulator-... 91 2e-16 dbj|BAE72697.1| pseudo-response regulator 37 homologue [Lemna pa... 91 2e-16 dbj|BAE72700.1| pseudo-response regulator 37 homologue [Lemna gi... 91 2e-16 ref|XP_006594104.1| PREDICTED: two-component response regulator-... 91 2e-16 ref|XP_003536977.1| PREDICTED: two-component response regulator-... 91 2e-16 emb|CBI16234.3| unnamed protein product [Vitis vinifera] 91 2e-16 ref|XP_002281776.1| PREDICTED: two-component response regulator-... 91 2e-16 ref|XP_002525199.1| sensory transduction histidine kinase, putat... 91 2e-16 >ref|XP_006280424.1| hypothetical protein CARUB_v10026357mg [Capsella rubella] gi|482549128|gb|EOA13322.1| hypothetical protein CARUB_v10026357mg [Capsella rubella] Length = 464 Score = 92.4 bits (228), Expect = 6e-17 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +3 Query: 3 MSSHNSMGTVFKCLSNGAVDFLLKPIRKNELKNLWQHVWKRCHSVSCYVLS 155 MSSH+SM VFKCLSNGAVDFL+KPIRKNELKNLWQHVW+RCHS+ C + S Sbjct: 107 MSSHDSMVLVFKCLSNGAVDFLVKPIRKNELKNLWQHVWRRCHSLLCGLCS 157 >gb|AFW88754.1| hypothetical protein ZEAMMB73_978741 [Zea mays] Length = 743 Score = 92.4 bits (228), Expect = 6e-17 Identities = 40/52 (76%), Positives = 47/52 (90%) Frame = +3 Query: 3 MSSHNSMGTVFKCLSNGAVDFLLKPIRKNELKNLWQHVWKRCHSVSCYVLST 158 MS+++SM VFKCLS GAVDFL+KP+RKNELKNLWQHVW+RCHSVSC LS+ Sbjct: 164 MSTNDSMSMVFKCLSKGAVDFLVKPLRKNELKNLWQHVWRRCHSVSCLFLSS 215 >gb|EYU41647.1| hypothetical protein MIMGU_mgv1a002467mg [Mimulus guttatus] Length = 658 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 3 MSSHNSMGTVFKCLSNGAVDFLLKPIRKNELKNLWQHVWKRCHSVS 140 MSSH+SMG VFKCLS GAVDFL+KPIRKNELKNLWQHVW+RCHS S Sbjct: 147 MSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 192 >gb|EYU41646.1| hypothetical protein MIMGU_mgv1a002467mg [Mimulus guttatus] Length = 670 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 3 MSSHNSMGTVFKCLSNGAVDFLLKPIRKNELKNLWQHVWKRCHSVS 140 MSSH+SMG VFKCLS GAVDFL+KPIRKNELKNLWQHVW+RCHS S Sbjct: 147 MSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 192 >gb|EXC33207.1| Two-component response regulator-like protein [Morus notabilis] Length = 755 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 3 MSSHNSMGTVFKCLSNGAVDFLLKPIRKNELKNLWQHVWKRCHSVS 140 MSSH+SMG VFKCLS GAVDFL+KPIRKNELKNLWQHVW+RCHS S Sbjct: 153 MSSHDSMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 198 >ref|XP_006594103.1| PREDICTED: two-component response regulator-like APRR7-like isoform X1 [Glycine max] Length = 755 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 3 MSSHNSMGTVFKCLSNGAVDFLLKPIRKNELKNLWQHVWKRCHSVS 140 MSSH+SMG VFKCLS GAVDFL+KPIRKNELKNLWQHVW+RCHS S Sbjct: 168 MSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 213 >ref|XP_006588746.1| PREDICTED: two-component response regulator-like APRR7-like isoform X3 [Glycine max] Length = 749 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 3 MSSHNSMGTVFKCLSNGAVDFLLKPIRKNELKNLWQHVWKRCHSVS 140 MSSH+SMG VFKCLS GAVDFL+KPIRKNELKNLWQHVW+RCHS S Sbjct: 166 MSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 211 >ref|XP_006588745.1| PREDICTED: two-component response regulator-like APRR7-like isoform X2 [Glycine max] Length = 753 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 3 MSSHNSMGTVFKCLSNGAVDFLLKPIRKNELKNLWQHVWKRCHSVS 140 MSSH+SMG VFKCLS GAVDFL+KPIRKNELKNLWQHVW+RCHS S Sbjct: 166 MSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 211 >ref|XP_007027202.1| Sensory transduction histidine kinase, putative isoform 6 [Theobroma cacao] gi|508715807|gb|EOY07704.1| Sensory transduction histidine kinase, putative isoform 6 [Theobroma cacao] Length = 606 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 3 MSSHNSMGTVFKCLSNGAVDFLLKPIRKNELKNLWQHVWKRCHSVS 140 MSSH+SMG VFKCLS GAVDFL+KPIRKNELKNLWQHVW+RCHS S Sbjct: 1 MSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 46 >ref|XP_007027200.1| Sensory transduction histidine kinase, putative isoform 4 [Theobroma cacao] gi|590630185|ref|XP_007027201.1| Pseudo-response regulator 7, putative isoform 4 [Theobroma cacao] gi|508715805|gb|EOY07702.1| Sensory transduction histidine kinase, putative isoform 4 [Theobroma cacao] gi|508715806|gb|EOY07703.1| Pseudo-response regulator 7, putative isoform 4 [Theobroma cacao] Length = 615 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 3 MSSHNSMGTVFKCLSNGAVDFLLKPIRKNELKNLWQHVWKRCHSVS 140 MSSH+SMG VFKCLS GAVDFL+KPIRKNELKNLWQHVW+RCHS S Sbjct: 1 MSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 46 >ref|XP_007027197.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] gi|590630175|ref|XP_007027198.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] gi|590630179|ref|XP_007027199.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] gi|508715802|gb|EOY07699.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] gi|508715803|gb|EOY07700.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] gi|508715804|gb|EOY07701.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] Length = 783 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 3 MSSHNSMGTVFKCLSNGAVDFLLKPIRKNELKNLWQHVWKRCHSVS 140 MSSH+SMG VFKCLS GAVDFL+KPIRKNELKNLWQHVW+RCHS S Sbjct: 169 MSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 214 >ref|XP_004169415.1| PREDICTED: two-component response regulator-like APRR7-like [Cucumis sativus] Length = 794 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 3 MSSHNSMGTVFKCLSNGAVDFLLKPIRKNELKNLWQHVWKRCHSVS 140 MSSH+SMG VFKCLS GAVDFL+KPIRKNELKNLWQHVW+RCHS S Sbjct: 170 MSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 215 >ref|XP_004142221.1| PREDICTED: two-component response regulator-like APRR7-like [Cucumis sativus] Length = 797 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 3 MSSHNSMGTVFKCLSNGAVDFLLKPIRKNELKNLWQHVWKRCHSVS 140 MSSH+SMG VFKCLS GAVDFL+KPIRKNELKNLWQHVW+RCHS S Sbjct: 170 MSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 215 >dbj|BAE72697.1| pseudo-response regulator 37 homologue [Lemna paucicostata] Length = 617 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 3 MSSHNSMGTVFKCLSNGAVDFLLKPIRKNELKNLWQHVWKRCHSVS 140 MSSH+SMG VFKCLS GAVDFL+KPIRKNELKNLWQHVW+RCHS S Sbjct: 158 MSSHDSMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 203 >dbj|BAE72700.1| pseudo-response regulator 37 homologue [Lemna gibba] Length = 623 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 3 MSSHNSMGTVFKCLSNGAVDFLLKPIRKNELKNLWQHVWKRCHSVS 140 MSSH+SMG VFKCLS GAVDFL+KPIRKNELKNLWQHVW+RCHS S Sbjct: 158 MSSHDSMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 203 >ref|XP_006594104.1| PREDICTED: two-component response regulator-like APRR7-like isoform X2 [Glycine max] Length = 749 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 3 MSSHNSMGTVFKCLSNGAVDFLLKPIRKNELKNLWQHVWKRCHSVS 140 MSSH+SMG VFKCLS GAVDFL+KPIRKNELKNLWQHVW+RCHS S Sbjct: 162 MSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 207 >ref|XP_003536977.1| PREDICTED: two-component response regulator-like APRR7-like isoform X1 [Glycine max] Length = 747 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 3 MSSHNSMGTVFKCLSNGAVDFLLKPIRKNELKNLWQHVWKRCHSVS 140 MSSH+SMG VFKCLS GAVDFL+KPIRKNELKNLWQHVW+RCHS S Sbjct: 160 MSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 205 >emb|CBI16234.3| unnamed protein product [Vitis vinifera] Length = 482 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 3 MSSHNSMGTVFKCLSNGAVDFLLKPIRKNELKNLWQHVWKRCHSVS 140 MSSH+SMG VFKCLS GAVDFL+KPIRKNELKNLWQHVW+RCHS S Sbjct: 176 MSSHDSMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 221 >ref|XP_002281776.1| PREDICTED: two-component response regulator-like PRR73-like [Vitis vinifera] Length = 785 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 3 MSSHNSMGTVFKCLSNGAVDFLLKPIRKNELKNLWQHVWKRCHSVS 140 MSSH+SMG VFKCLS GAVDFL+KPIRKNELKNLWQHVW+RCHS S Sbjct: 176 MSSHDSMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 221 >ref|XP_002525199.1| sensory transduction histidine kinase, putative [Ricinus communis] gi|223535496|gb|EEF37165.1| sensory transduction histidine kinase, putative [Ricinus communis] Length = 762 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 3 MSSHNSMGTVFKCLSNGAVDFLLKPIRKNELKNLWQHVWKRCHSVS 140 MSSH+SMG VFKCLS GAVDFL+KPIRKNELKNLWQHVW+RCHS S Sbjct: 169 MSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 214