BLASTX nr result
ID: Akebia23_contig00007523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00007523 (1026 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006451596.1| hypothetical protein CICLE_v10009694mg [Citr... 39 5e-06 >ref|XP_006451596.1| hypothetical protein CICLE_v10009694mg [Citrus clementina] gi|557554822|gb|ESR64836.1| hypothetical protein CICLE_v10009694mg [Citrus clementina] Length = 173 Score = 39.3 bits (90), Expect(2) = 5e-06 Identities = 17/34 (50%), Positives = 24/34 (70%) Frame = +3 Query: 624 EGFLKGFQNESIVILHSILSPIHIKKLEKHLTGS 725 EG LKG Q +++IL S + P H++KLEK TG+ Sbjct: 80 EGVLKGLQKGAVIILQSTILPSHMQKLEKTFTGN 113 Score = 38.9 bits (89), Expect(2) = 5e-06 Identities = 17/44 (38%), Positives = 27/44 (61%) Frame = +1 Query: 499 VMDEFLKLGEAKCASPMVKRRDAAATIICTSSAYQIDDVLFGKD 630 ++D+F LG + ASPM +D +A ++ S QIDD+ FG + Sbjct: 37 LVDKFFMLGGIRSASPMDAGKDVSALVVVISHVDQIDDIFFGHE 80